CAZyme Information: MGYG000001936_00158

Basic Information

• Species: UBA5905 sp002437905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA5905; UBA5905 sp002437905
• CAZyme ID: MGYG000001936_00158
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
752		84774.94	5.794

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001936	2006126	MAG	Denmark	Europe

• Gene Location: Start: 63399; End: 65657 Strand: -

Full Sequence      

MPFHTNEFICYPEPYSPDFSWDDPAPLFRRHFVVENGLQGAGLSICALGLGEAYLNGRPV
TQDRYISPVGNYDKTLWYTEYTVTELLHPGDNLAAVALGNGLYNEGLHTAWDFDAAPWRD
VPKLLFSLELRYADHTEHIGSDTVWLCMRARSPYRFHQLRYGEYYDARCQVDWMQPSATE
ASWVPAALASRPAGRLRLCPCPPIREERTYACVRMFHNDHGGWVFDFGQNMSGYVELTTV
QPAGTRLRLIYAEELNDDGTRRDNSLEKYYADTNAAGDRTQIGYLTCSGNTDRWKPTFAY
YGFRYVIVEGMESPPQMDCLTAYFVHQQLPVLGRFACSEAVLNKLYDCSRISTLSNLFYV
PTDCPTREKLGWCNDAQASAEQMIQNLDMRGFYNKWMRDILDAQRPDGDLPGIVPTGGWG
YDWGSGPISTGILFEIPARLYQYYGDTNWLCKAYPAMRRHLNFLEGKVDPCTGLCAHGLS
DWAGPFDPGDDEPVPLSFTCTLLLIRFYRIAQLAAGFAGEAAALPALEAAENRAIAAFRR
AYVRPDGGCRIEQQTAVAMMTVLGLYGDTALARQQLLKTFEKRQYHFYLGMLGMQYLLPA
CDICGLQEEGYRLLTAHGYPSYREWVARGATTLYEHFQEGTSKNHHMYSCVIAWFHNTIL
GIRQTQDLALHGTITLSPCFLSELQFAEGSFETVAGRIAVGWRRQEDGYVQLTVEIPAGV
RATLHLTGYAADGQTDRLLAAGKQQFVAKKVQ

Enzyme Prediction     

No EC number prediction in MGYG000001936_00158.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	217	726	4.4e-120	0.9940476190476191
CBM67	22	190	6.2e-23	0.8863636363636364

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.53e-62	333	659	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.30e-35	41	205	6	169	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.12e-20	221	326	6	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.43e-14	673	728	11	65	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ94103.1	1.30e-124	24	724	142	838
AYB33152.1	2.29e-123	23	742	182	888
AHF16194.1	3.51e-120	25	728	172	863
AQS56111.1	2.56e-118	22	726	263	972
QHS62552.1	3.80e-117	25	746	39	759

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.48e-89	25	726	176	898	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	5.98e-72	41	722	319	990	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	3.70e-59	28	728	134	848	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
2OKX_A	6.49e-11	224	726	440	941	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	1.96e-76	25	743	184	919	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	2.92e-71	41	722	319	990	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	1.05e-61	16	722	161	874	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001936_00158.