CAZyme Information: MGYG000001936_00283

Basic Information

• Species: UBA5905 sp002437905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA5905; UBA5905 sp002437905
• CAZyme ID: MGYG000001936_00283
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
736	MGYG000001936_4|CGC1	80906.05	5.5691

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001936	2006126	MAG	Denmark	Europe

• Gene Location: Start: 11461; End: 13671 Strand: -

Full Sequence      

MNAFSAEIHLADWVVAPKAFPAPVISRLFHADGLQKAGIALSALGSFVLYVNGKRVGNDY
FLPANSLYRARSKTAFLYPTRDDFTYRCYYTVYDLTPYVKDGENRLEIALGNGWYRQTER
TAEGNVAFGDRLGAIYALTLEDKAGRRTLLSDGTEDCRTCNTLASDLFYGETYDARCTEF
THAPVDILKLPDTLLTPDDAPPDRVFRTLESKQLFADGSRQLYDAGENISGFVCIETDAP
AGEPVRIRYAETIRGNELFFGGTGDDFRSPSGVQQIMQDTFIGDGHRHVFEPQFLWHAFR
YFEICGNGRPLCVKVIHSDVPITSAFHSSSPELNWLYTAFLRTQTANMHQGVPLDCPHRE
RLGYTGDGQVCAPAAMQMLGAQAFYRKWIRDIFDSQDSKTGHVNHTAPFAGGGGGPGGWG
MAAITVPYHYYVLYGDITPAKEHYEGIKKWINYLIAHSENGLVVREEEGGWCLGDWNAPE
PMALDPAFVNTCLFIRALRFAGVIARGLGQPEDADRFNRLIDTAGAAVVRDYYNATTHSF
ADGLQGADAFAVAAGLGDAATMENLKQKYAALGHFDTGFLATDLLIQVLLENGGEDIAFA
LLTSHTPGSSFGDWMDKGATTIWETWRGDNSLNHPMFGACSRMLFSGILGIRPAADPTGS
APLLIAPKTPEGLRFAEGYTTLPGGRLSVSWRREAAQIRFTVTVPEKQTAVFRYGETAMP
LHSGTNHFLCAQETGA

Enzyme Prediction     

No EC number prediction in MGYG000001936_00283.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	218	711	1.3e-116	0.9801587301587301

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.72e-68	323	639	3	331	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	3.85e-26	42	205	11	170	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	6.32e-07	222	317	9	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	3.13e-05	650	710	1	59	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS97255.1	2.02e-173	11	728	6	722
QOY86540.1	5.42e-136	21	711	150	839
BCJ98018.1	2.01e-118	10	705	124	849
QUT50058.1	3.85e-113	21	728	160	874
QMW80401.1	6.77e-95	11	729	125	848

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	3.02e-61	11	710	285	990	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	6.96e-57	22	705	176	889	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	4.19e-44	32	691	142	816	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	1.54e-60	11	710	285	990	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	4.51e-58	36	712	185	876	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	4.51e-55	34	705	197	897	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	5.84e-51	31	710	184	874	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999916	0.000085	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001936_00283.