CAZyme Information: MGYG000001936_00702

Basic Information

• Species: UBA5905 sp002437905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA5905; UBA5905 sp002437905
• CAZyme ID: MGYG000001936_00702
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
493		53601.4	7.1481

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001936	2006126	MAG	Denmark	Europe

• Gene Location: Start: 46392; End: 47873 Strand: -

Full Sequence      

MAFNGFSGGRHSAPMHLPAWLLPAVGGVTAAALAVTGVLAVTRSLQHRRLVPTAASSAVS
APLLTTAPATTETATTTETPTTTTTTTGRTTRKVIPSVKPPVIRVEQNEVTTTKRTETRV
TGTHTDYQPVRPDRVSLPDLPHLYGSNGQLVGIDVWRGTEEIDWPTVKQAGIRFAMIRCG
YRTTVGGVVYKDANFDKNIRGALDAGIPVGVYFFSAAKNRQEALEEAAFTLEVIKEYNIT
WPVAYDFETFGSDRLTGVSNTTITDNAMAFMDYIAQNGYTPVLYSYRNALWNNWEAARLG
AYRVWMAQYAELPKKSYGGDHAIWQCASDGIVPGIAEKNYVDLNIAYMDFSKPHTALLNE
PDPSTFPTEFSGFSFTEVSDKVALQSACALRIAPDEKKPNIWRHAEKGLTLVRTGVDEKT
GWSRLLLNGVTVYCPSDKLQYLGQIPTTTTTTTVTTTTSTSATGTTTTTATDASIPPTTQ
GTTAAEEKIQKKD

Enzyme Prediction     

No EC number prediction in MGYG000001936_00702.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	153	335	1.6e-40	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	8.65e-72	152	347	3	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	1.98e-32	152	346	2	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	1.79e-31	153	335	1	180	Glycosyl hydrolases family 25.
cd06525	GH25_Lyc-like	1.08e-23	152	344	2	182	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd06413	GH25_muramidase_1	4.51e-21	152	347	5	190	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK93417.1	8.08e-49	152	439	96	391
ACR73526.1	9.03e-49	151	439	122	418
CBK89713.1	8.06e-48	152	439	96	391
ACR77025.1	1.55e-47	152	439	96	391
QCT06482.1	1.98e-47	145	345	115	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WW5_A	7.61e-11	153	347	272	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
2WWC_A	1.34e-10	153	347	272	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000085	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	42