CAZyme Information: MGYG000001937_01264

Basic Information

• Species: UBA7173 sp001701135
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173; UBA7173 sp001701135
• CAZyme ID: MGYG000001937_01264
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
867	MGYG000001937_14|CGC1	96017.19	6.3332

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001937	2244087	MAG	Denmark	Europe

• Gene Location: Start: 4269; End: 6872 Strand: -

Full Sequence      

MNKTLAIAALSAILGSSAMQAAVPAMPVTVGHRTGALPADLWSCSQWIAVPGAPEIKSLV
NEDHQRAADGASWFATTLKNDRKVKKAVWMTTGLGVYQLYVNGKPVGEEVLRPGFTHIDK
TRRSFTYDITDAINRKSGAENTLSVQSTPGWWADRIVTSDNPNGMKGGKPAFRSVVEITY
DDGSTVCVGTDPSWKAAIAGPVTHAGIYDGEAYDDRIPMGYETISSFGNAEPYTRFNGEI
LPSAGGEIYTRPDLMLQPVDAYVWEGISGADDTHYGKVNITRRIPSGKKFTVKPGETLVV
DFGQNAAAIPVFEFSAPEGTKLECCFAEILNDGNGAHSRGMDGPEGSAHMRNLRIYDKGM
LRLDYIFGHNGKMVTYKPDCTFYGYRYLSLTADRPVTIKSVESLPVTSIAAAHEIGRITT
GNADINKLISNTRWGQLSNYLSVPTDCPQRNERLGWTADTQVFTETGSFFANTRDFFHKW
TRDLRDNQHPAGGYPGVAPGGIYGANLDNETSRLGWSDAGVIVPYTIWKQFADTAIVNQN
WEAMMKYMKLLDRTGAEHENLIPYNGDFQWGDWLSYEPLESCGGGINHVVDGKVQHRPEA
REYWAYLQGCYWISNAEMMAEMARATGRDDSRLKSMAQRARDYVKARHLNDDGTFRCDIL
NTMQTPALFAMRNKLVEGKNLENMKQRLRDNFASHGNCLQTGFLGTSILLPTLTENGMVD
IAYELLLQRKNPSWLYSVDNGATTIWERWNSYTLDKGMGEAGMNSFNHYAYGVVCQWIWN
TMAGIQSDPAQPGFRHIIMKPIPDKRIGSLKAEYASTAGLIKSEWKYDGDLCTWNFTIPE
GSTATVTLPVEGATPKEYTAGTYTLTF

Enzyme Prediction     

No EC number prediction in MGYG000001937_01264.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	292	848	7.9e-136	0.9920634920634921
CBM67	46	216	2.7e-19	0.8181818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.91e-97	414	782	2	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	6.10e-33	83	219	2	134	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	1.86e-17	784	851	1	66	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	1.59e-11	291	395	2	91	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK93107.1	0.0	31	863	36	864
QUR48396.1	0.0	31	863	36	864
QUT20979.1	0.0	31	863	28	856
QIX65068.1	0.0	31	863	36	864
QJE29828.1	0.0	31	863	36	864

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	1.96e-102	82	863	314	1009	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.64e-75	92	863	152	861	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	1.07e-68	71	849	176	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	8.61e-102	82	863	314	1009	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	1.74e-100	78	853	183	883	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	2.46e-89	42	839	146	869	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	2.74e-48	33	848	137	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000238	0.999137	0.000153	0.000168	0.000145	0.000129

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001937_01264.