CAZyme Information: MGYG000001938_01743

Basic Information

• Species: CAG-873 sp001701165
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp001701165
• CAZyme ID: MGYG000001938_01743
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
265	MGYG000001938_25|CGC1	31539.23	8.4266

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001938	2473241	MAG	Denmark	Europe

• Gene Location: Start: 18601; End: 19398 Strand: +

Full Sequence      

MIPKIIHLCWLSGDPYPTDIQLCLDSWKKHLPDYEIWLWDTKRFDIDSTRWTRQAFDAKK
YAFAADYIRLYALYNYGGIYLDSDVLVYKSFDPLLSLPYFVGHDQAGCFEAAVIGCEPGC
QWIKDILDSYEGMPFIREDGTYDMLPMPCRFRFVLSDKGYKFYKIKHLEDLDASQYDITQ
KQMYVFDGQHFNGRDSLDVHPTKKSYCSHNYAGSWKKQEKNFLKSILPKWIVKTIYAIGW
RTWRKKEFSKYQIPFEKKQRRCTQA

Enzyme Prediction     

No EC number prediction in MGYG000001938_01743.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	20	95	1.5e-20	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	3.95e-19	1	131	81	215	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	1.60e-15	17	100	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	1.06e-09	1	92	45	141	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	1.34e-04	61	86	170	195	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
pfam12919	TcdA_TcdB	5.72e-04	4	39	1	35	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT76540.1	1.01e-80	1	215	1	215
AST53761.1	4.51e-77	1	215	1	216
ABR43046.1	4.51e-77	1	215	1	216
QCY56520.1	4.51e-77	1	215	1	216
QUT95190.1	4.51e-77	1	215	1	216

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q10323	4.28e-10	2	135	57	193	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
Q9UT67	1.10e-08	1	131	81	214	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
P33300	7.09e-08	1	141	54	203	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
P38287	2.27e-07	1	129	61	192	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
Q5ZU30	1.27e-06	2	188	28	258	Subversion of eukaryotic traffic protein A OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=setA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001938_01743.