CAZyme Information: MGYG000001939_00801

Basic Information

• Species: UBA10281 sp900767815
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA10281; UBA10281 sp900767815
• CAZyme ID: MGYG000001939_00801
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
536		60886.56	5.2998

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001939	2180868	MAG	Denmark	Europe

• Gene Location: Start: 3125; End: 4735 Strand: +

Full Sequence      

MENIFPVRIVAEHGVLNAENLLKHKTLQIGLSEVDQVFFDKNSYVILDYGKEYSGSLRFI
SFLTSGAGKIRVRLGESVSEVCHDIGEKNATNDHSTRDWTFFVPNYSDQTFLNSGFRFAR
IDLLEDTTLNVKSIVCKSDMYEKEFDGSFRCSDERINEIFDVAAYTFRLCIHNDMIWDGV
KRDRLVWIGDLHPEQMTADCLYENTDFIRNSISFAKDQTVLPKWMNNMPTYSLWWIINLR
DYYFRTGDKKFVEQFGDYLVATLKQIDGCVKDNGETEFPFNFVDWPSHPKTPDETVKIYD
EAAGVHALVYWCMNCTKELLSAIGRPCDIADSILVKLSKISYSVKQFKQISAIRLIAGIG
DEKDVGLILKNGAEGLSTFMSYYLFRSISDKGYGKEAVSMMKEYYGKMLDLGATTFWEDF
DIKWAENAGRIDEIPEKGKVDIHADKGAFCYVGLRHSFCHGWSSGVVPFLMRYVAGIEEV
GVGGKEIVVKPDLCGLGFVDVVYPLTSGKVYIKIRNENGKTITEVKAPEGIKVTVL

Enzyme Prediction     

No EC number prediction in MGYG000001939_00801.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	41	535	4.6e-83	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.89e-15	147	474	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	0.002	476	535	1	61	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VTP90849.1	6.96e-129	2	533	38	575
QUT42018.1	6.42e-124	45	533	94	588
QBQ39947.1	6.54e-124	2	533	40	577
BCA48698.1	9.06e-124	45	533	94	588
QUT69834.1	2.55e-123	45	533	94	588

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	7.78e-30	45	530	194	688	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	4.33e-25	37	535	431	939	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	4.20e-15	45	473	95	541	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]
6GSZ_A	4.11e-07	6	218	308	501	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001939_00801.