CAZyme Information: MGYG000001939_01285

Basic Information

• Species: UBA10281 sp900767815
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA10281; UBA10281 sp900767815
• CAZyme ID: MGYG000001939_01285
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401		45161.41	6.3987

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001939	2180868	MAG	Denmark	Europe

• Gene Location: Start: 5389; End: 6594 Strand: +

Full Sequence      

MKVLMINSVCGIGSTGRICTDIADELTENGHECKIAFGRKTAPERYQKYAYRITSDGGVK
INALKARLFDNEGFNAARATKKLISFIEEYNPDVIHLHNLHGYYLNVEVLFDYLKKADKK
VVWTLHDCWAFTGHCAYFDYPECDKWRENCGNCGRLNDYPKAIIDRSERNLAKKKEIFRG
VKNLTVVTPSKWLAELAKQSFLGEYLIEVINNGIDTAVFHPTESNFKEKNGLSGKKIILG
VANIWDARKGLGDFISLSKKISDDYRIVLVGLDEKQLGMLPENILGITRTSSAKELAEIY
TAADVLFNPTYEDNYPTVNLEAQACKTPVVTYDTGGSSETIFLDNGKVVEKGDLESAFEK
IKFYAENTADGKSAESDSEIYEIGKKIDKRVAVEYYIKLYS

Enzyme Prediction     

No EC number prediction in MGYG000001939_01285.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03825	GT4_WcaC-like	3.44e-109	1	400	1	361	putative colanic acid biosynthesis glycosyl transferase WcaC and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Escherichia coli WcaC has been predicted to function in colanic acid biosynthesis. WcfI in Bacteroides fragilis has been shown to be involved in the capsular polysaccharide biosynthesis.
cd03801	GT4_PimA-like	1.32e-34	2	400	1	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
PRK10125	PRK10125	4.01e-31	1	353	1	357	colanic acid biosynthesis glycosyltransferase WcaC.
COG0438	RfaB	4.82e-26	1	401	3	375	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03798	GT4_WlbH-like	6.72e-23	70	401	74	374	Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZR73927.1	4.47e-151	1	398	1	400
AFG34269.1	1.93e-149	1	341	1	340
AMW31976.1	9.00e-148	1	341	1	340
CEP78286.1	6.71e-147	1	401	1	397
ANQ53651.1	2.08e-146	1	400	1	396

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KIH_A	9.22e-06	166	341	177	362	Sucrose-phosphatesynthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_B Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_C Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_D Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_E Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_F Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_G Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_H Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_I Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_J Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_K Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_L Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71237	7.08e-26	1	354	1	358	Putative colanic acid biosynthesis glycosyl transferase WcaC OS=Escherichia coli (strain K12) OX=83333 GN=wcaC PE=4 SV=2
C8XA09	7.46e-07	194	336	205	365	D-inositol 3-phosphate glycosyltransferase OS=Nakamurella multipartita (strain ATCC 700099 / DSM 44233 / CIP 104796 / JCM 9543 / NBRC 105858 / Y-104) OX=479431 GN=mshA PE=3 SV=1
Q8KQL6	2.98e-06	180	333	100	262	Processive diacylglycerol alpha-glucosyltransferase OS=Acholeplasma laidlawii OX=2148 GN=dgs PE=1 SV=1
P39862	3.45e-06	211	362	171	333	Capsular polysaccharide biosynthesis glycosyltransferase CapM OS=Staphylococcus aureus OX=1280 GN=capM PE=3 SV=1
A0JZ09	8.81e-06	177	342	166	345	D-inositol 3-phosphate glycosyltransferase OS=Arthrobacter sp. (strain FB24) OX=290399 GN=mshA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001939_01285.