CAZyme Information: MGYG000001939_01780

Basic Information

• Species: UBA10281 sp900767815
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA10281; UBA10281 sp900767815
• CAZyme ID: MGYG000001939_01780
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549		62431.51	5.5019

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001939	2180868	MAG	Denmark	Europe

• Gene Location: Start: 188; End: 1837 Strand: +

Full Sequence      

MSKKYIYPTRIIDSSKNIANDVCLLKERTYLQIGINESEYAIFASGSFIILDFGKELCGG
VRILTYQAQDDCRIRIRFGESVSECCAEIGENSASNDHSPRDIVEQLVSFSDLEFGQSGF
RFVRIDVLCGELKIKNVVAASLIAETNRSGYFNCDDDRVNKIFETAAYTLELCQRNGMLW
DGIKRDRLVWGGDLHAQMLGTLSLFDAGEHVRRSLRFLREQTPLPDFINDLPVYSLWWIA
AVTDYYMYTADEGFLRENAEYVKTLIGLFSSSIDENGDMIFPNVADPYFFDLDTYRSPDS
KAGVYAVAEYVFCKLEGVAEKIGISGTVLSEMRRKLRKDIPGGDRAQIIAMQTLGKKQVI
EAETEKLKNLTPKDITAFMSYYIFSAMAKSGFCEKAFRIMKEYYGTMLSLGSTTFWEEFR
TEWAENSIRLDEVPVKGKKNAHADYGAYCYSGLRKSLCHGWSASPVPFIVKYVLGIRILD
PGYKKIRISPDLCGLRWVEGGIPTPYGSMKIFIRREENGLEVRLIAPREISVEPDQNIKE
RFIREICEK

Enzyme Prediction     

No EC number prediction in MGYG000001939_01780.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	49	313	1.7e-43	0.5257936507936508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.20e-11	148	417	2	310	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.83e-07	475	533	1	60	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	0.009	94	338	187	455	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEC52590.1	1.30e-113	3	532	43	585
BBE16159.1	1.79e-113	3	532	40	582
QUR50485.1	6.30e-113	2	534	26	582
QEC57280.1	1.11e-112	1	532	43	594
BBK91321.1	3.51e-112	49	534	78	582

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	5.39e-41	49	512	194	675	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	1.97e-23	119	532	504	937	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	1.60e-18	44	474	90	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001939_01780.