CAZyme Information: MGYG000001944_00321

Basic Information

• Species: Selenomonas_C sp002351185
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Selenomonas_C; Selenomonas_C sp002351185
• CAZyme ID: MGYG000001944_00321
• CAZy Family: GT41
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
517		56516.01	9.0349

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001944	2012593	MAG	Denmark	Europe

• Gene Location: Start: 20601; End: 22154 Strand: +

Full Sequence      

MADLFADYARALAALRGGQLEKAAAQAAALMRRAPRWEKPRLLAAYAARASGQYEEEIAL
LAPLRASASSPALRAEAYSLSAAARSLLGEGVQAVADYLTAARLEPDSGQQRVELSNAEF
AACYVDFPPETFQAIHRRYQASLAGIRPLPQPRYDHARLRVGYLSANFRAHPLAFFFWPL
LLHHDRTRVEVYCYAAGTREDAYTRAMRARADVWRAAAGDSDEALARRIREDEIDVLVEL
DGHTGGNRLPVLAYRPAPVLLSGIGYMGSTGLPFLDGFLLDASCAPHLAQAQAYFAEPLR
LLPTCHLCYAPIKEMPAPGALPALRSGTVTFGCLNNFSKVTEALLVDWAAILERVPGSRL
LVKHRIFDSAEGRRRVRARLTRAGIDPARVTMEGLSRDYLTAYQRIDIALDTYPYVGVLT
TCEALMMGVPVITRAGVRPGSAFGRSLLGAAGLGELVTTSRAAYCDRAVALAGDVPLLAA
LRAQLRGMLLTSPLLDGRRYAREVEELFRARVQEKHL

Enzyme Prediction     

No EC number prediction in MGYG000001944_00321.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	22	516	5.4e-103	0.6425531914893617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3914	Spy	3.41e-86	57	508	159	611	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
pfam13844	Glyco_transf_41	1.07e-21	92	501	15	540	Glycosyl transferase family 41. This family of glycosyltransferases includes O-linked beta-N-acetylglucosamine (O-GlcNAc) transferase, an enzyme which catalyzes the addition of O-GlcNAc to serine and threonine residues. In addition to its function as an O-GlcNAc transferase, human OGT also appears to proteolytically cleave the epigenetic cell-cycle regulator HCF-1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOH48972.1	2.34e-107	75	508	124	559
BAL84160.1	2.86e-107	42	514	443	919
QNH55417.1	1.18e-103	75	508	124	559
AKT53743.1	1.81e-103	75	510	125	562
ANR70172.1	2.48e-103	75	508	124	559

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DJS_A	1.18e-56	137	509	141	513	Thermobaculumterrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_B Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_C Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_D Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum]
2VSN_A	2.33e-30	80	485	147	533	Structureand topological arrangement of an O-GlcNAc transferase homolog: insight into molecular control of intracellular glycosylation [Xanthomonas campestris pv. campestris str. 8004],2VSN_B Structure and topological arrangement of an O-GlcNAc transferase homolog: insight into molecular control of intracellular glycosylation [Xanthomonas campestris pv. campestris str. 8004]
2JLB_A	2.33e-30	80	485	147	533	Xanthomonascampestris putative OGT (XCC0866), complex with UDP- GlcNAc phosphonate analogue [Xanthomonas campestris pv. campestris],2JLB_B Xanthomonas campestris putative OGT (XCC0866), complex with UDP- GlcNAc phosphonate analogue [Xanthomonas campestris pv. campestris],2VSY_A Xanthomonas campestris putative OGT (XCC0866), apostructure [Xanthomonas campestris pv. campestris str. ATCC 33913],2VSY_B Xanthomonas campestris putative OGT (XCC0866), apostructure [Xanthomonas campestris pv. campestris str. ATCC 33913],2XGM_A Substrate and product analogues as human O-GlcNAc transferase inhibitors. [Xanthomonas campestris],2XGM_B Substrate and product analogues as human O-GlcNAc transferase inhibitors. [Xanthomonas campestris],2XGO_A XcOGT in complex with UDP-S-GlcNAc [Xanthomonas campestris],2XGO_B XcOGT in complex with UDP-S-GlcNAc [Xanthomonas campestris],2XGS_A XcOGT in complex with C-UDP [Xanthomonas campestris],2XGS_B XcOGT in complex with C-UDP [Xanthomonas campestris]
5A01_A	2.64e-20	158	516	234	698	O-GlcNActransferase from Drososphila melanogaster [Drosophila melanogaster],5A01_B O-GlcNAc transferase from Drososphila melanogaster [Drosophila melanogaster],5A01_C O-GlcNAc transferase from Drososphila melanogaster [Drosophila melanogaster]
5HGV_A	1.80e-17	133	508	199	698	Structureof an O-GlcNAc transferase point mutant, D554N in complex with peptide [Homo sapiens],5HGV_C Structure of an O-GlcNAc transferase point mutant, D554N in complex with peptide [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8RVB2	9.92e-70	159	510	488	844	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Solanum lycopersicum OX=4081 GN=SPY PE=2 SV=1
Q6YZI0	1.24e-68	103	509	416	829	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Oryza sativa subsp. japonica OX=39947 GN=SPY PE=2 SV=1
Q96301	1.42e-67	159	509	483	838	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana OX=3702 GN=SPY PE=1 SV=1
O82039	4.44e-67	158	510	487	844	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Petunia hybrida OX=4102 GN=SPY PE=2 SV=1
O82422	6.39e-66	103	510	416	830	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Hordeum vulgare OX=4513 GN=SPY PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001944_00321.