CAZyme Information: MGYG000001944_01657

Basic Information

• Species: Selenomonas_C sp002351185
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Selenomonas_C; Selenomonas_C sp002351185
• CAZyme ID: MGYG000001944_01657
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
440		47298.88	7.1182

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001944	2012593	MAG	Denmark	Europe

• Gene Location: Start: 1839; End: 3161 Strand: +

Full Sequence      

MPSIFPCHPRRTLTACLLACLVTSAAAAAPSALPAADEIAQRPITGPVTITRPDFGSEPP
APIDKKRAAALPFRLAPAATLPLLPDEAAPESVTIEGPAEATPEQMAAFIRRRNPQPKLN
CTVEELVNYYYEEAGREGIRPDIALCQALKETGFFAYGGDVIPSQNNFCGLGTTGGGVRG
AKFATPELGVRAHIQHLLAYASRELPATPVIDPRYELIVREHPDIHGQITRWTQLNGVWA
VPGKTYGQDILRLWAAAKAPDGSDASLAAAMAKVKNAPDDASAYLYRGIVYEKRGDLAAA
QSDFTAAHTLAPHELAALYDLALSTTASGDRKRALALYDALREEFPDFAPAAYNRGLLAL
AMNRPKDAIDDFRRALNANPQSAAAENGIAVARIALRDYDAAWRTLHRAAQINNADFDVL
ANQILLAACVRQEPAKAKKK

Enzyme Prediction     

No EC number prediction in MGYG000001944_01657.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
sd00006	TPR	2.62e-13	281	376	1	96	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
sd00006	TPR	4.07e-13	317	411	3	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
pfam01832	Glucosaminidase	2.50e-12	127	193	1	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
TIGR02917	PEP_TPR_lipo	4.71e-10	276	402	120	246	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.
COG0457	TPR	1.65e-09	246	413	94	266	Tetratricopeptide (TPR) repeat [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAL84275.1	2.15e-138	39	431	31	418
AME03363.1	3.94e-112	49	440	35	427
AKT53952.1	1.05e-111	49	440	33	425
AVO26228.1	1.38e-109	94	423	68	397
AOH47193.1	1.67e-109	48	440	39	432

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O51481	2.52e-15	104	234	50	180	Uncharacterized protein BB_0531 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0531 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.023759	0.948044	0.023801	0.003463	0.000556	0.000324

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001944_01657.