CAZyme Information: MGYG000001947_00404

Basic Information

• Species: UBA1777 sp900549545
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; UBA1777; UBA1777 sp900549545
• CAZyme ID: MGYG000001947_00404
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328		37393.82	6.407

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001947	2112314	MAG	Denmark	Europe

• Gene Location: Start: 59465; End: 60451 Strand: -

Full Sequence      

MNGCTQTGKPSISVLMSLYEPNLDWLRQQLVSIDAQDYPNVSLFIRDDCSPSVPFDEIER
CVRESVHNVPCVLKKGEQNLGYNKSFELMTGEAAGDYFAYCDQDDIWLENKLTVMMGALK
QHGAELVCSDMYIIDSAGNEIADSVTRVRRHHQFRSGYDLTDTLWHKNFVSGCAMLISAK
TARAALPFNPYMYYDHYLALYAANEGLVISLQQPLIRHREHGDNQSGIMLGVEDKSSYLK
LRIEVPLDSVRWLLENFPAKPRLKETLQDGLKWLEARQAYQKGDMTSGKTIFALRHFSPY
PSLFELAMPFMPKPVFNFIINASRKNIV

Enzyme Prediction     

No EC number prediction in MGYG000001947_00404.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04196	GT_2_like_d	1.17e-62	13	228	1	212	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	1.68e-11	13	176	1	159	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04184	GT2_RfbC_Mx_like	8.40e-11	10	139	1	129	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd00761	Glyco_tranf_GTA_type	2.19e-08	24	129	10	113	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
PRK10018	PRK10018	1.58e-07	15	127	6	114	colanic acid biosynthesis glycosyltransferase WcaA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBB65510.1	4.27e-117	1	328	1	327
QNK42418.1	1.84e-92	1	325	1	321
ACD23018.1	4.72e-76	6	328	2	322
CDH92154.1	4.72e-76	6	328	2	322
ALB44140.1	1.18e-73	8	328	15	333

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37783	9.70e-06	25	241	9	226	dTDP-rhamnosyl transferase RfbG OS=Shigella flexneri OX=623 GN=rfbG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001947_00404.