CAZyme Information: MGYG000001947_01477

Basic Information

• Species: UBA1777 sp900549545
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; UBA1777; UBA1777 sp900549545
• CAZyme ID: MGYG000001947_01477
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
613		68770.21	7.7368

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001947	2112314	MAG	Denmark	Europe

• Gene Location: Start: 15831; End: 17672 Strand: -

Full Sequence      

MYTLIRIALPIICAGLIVLFFAGLPNLKHCALPGIIPAERRFTRKDAAPLLAITLIYAIF
AFTGLGNRQSPESFAPMADNSAVITLPEGALPSGIMLFSGVGSGTYEIEYSEDGVNYTHA
ASFEQGYNSVLKWNSVPIETELVPRYVRVSSTGGNAYLGEFTLLDGDGVPISVSGCTAPE
LCDETALTPVKQTYFDEIYHARTAWEHLNNVYPYEVSHPPLGKEIMSLGIAIFGMTPFGW
RFCGTLFGVLMLPVMYLFLKRLFGGKAIPAAGTIIFAADFMHYAQTRIATIDTYALFFIL
LMYYFMYIWLSEKKHWALALSGLFFGIGAASKWTCIYAGAGLAVLWAAHWFNEFAPVIKT
RRRAKAALSSAWDSPEPELSNLEAIENAPLPLAAFFKNCLFCVVFFVLIPCVIYYFAYIP
YGAARGITPLSKEYLSIVLENQRFMFTYHAGVHSEHPYSSRWYQWVLNIRPILYYLEYFD
NGSRSSISSFLNPALCWGGFLSLFVLGYESIARRDKKAAFILIGYLAQLLPWVFITRITF
EYHYFACSAFLVLSLCYVFSILRQNSRRWRALTFGYAALCAALFLLFYPALSGKPIDNTW
GHALLGWLPTWPI

Enzyme Prediction     

No EC number prediction in MGYG000001947_01477.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	188	421	8.3e-52	0.9282511210762332

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16192	PMT_4TMC	4.94e-18	439	572	4	153	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
pfam02366	PMT	4.30e-14	192	354	20	204	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	1.28e-13	217	344	1	127	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
COG1928	PMT1	1.32e-13	195	346	50	225	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
COG1807	ArnT	5.35e-10	205	350	53	198	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU42918.1	2.40e-159	39	613	49	653
QQR07704.1	2.40e-159	39	613	49	653
QIA32159.1	3.81e-157	39	613	45	649
QBB67038.1	2.18e-133	44	613	74	752
ALP95330.1	4.33e-133	44	613	74	752

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WN04	4.28e-31	186	611	64	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	4.28e-31	186	611	64	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
L8F4Z2	1.90e-24	195	611	67	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
Q8NRZ6	1.11e-12	216	611	97	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999991	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	27
47	66
237	259
288	310
330	352
400	422
489	511
518	535
540	562
569	591