CAZyme Information: MGYG000001948_00189

Basic Information

• Species: Muribaculum sp002492595
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum sp002492595
• CAZyme ID: MGYG000001948_00189
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
200		22837.59	10.1033

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001948	2811075	MAG	Denmark	Europe

• Gene Location: Start: 12937; End: 13539 Strand: -

Full Sequence      

MNTLDTIMILAAMIAAPYPLSAQFHTITRDCPIEGHCFVKADKRIEDKHITDAMPLGNKS
EVVPVKTKKHSAFRNNGNVRKSKPETAIKDTLPLLTIPNLIAEINKNGIKFPKIVLAQAI
LETGWFKSSVCRNKHNLFGLTNPRTGEYYEFVHWTESVRAYYTKVQYRYKGGNYLLWLKN
IGYAEDPGYIRAVIRVLRQI

Enzyme Prediction     

No EC number prediction in MGYG000001948_00189.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	100	199	1.5e-17	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01832	Glucosaminidase	1.39e-15	98	162	2	78	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
COG1705	FlgJ	6.56e-13	105	200	59	182	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	2.03e-09	105	200	24	139	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK05684	flgJ	4.10e-07	108	200	171	297	flagellar assembly peptidoglycan hydrolase FlgJ.
NF038016	sporang_Gsm	1.89e-06	116	140	186	210	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD34777.1	2.81e-100	1	200	1	200
ANU62956.1	4.13e-97	4	200	2	198
QQR09706.1	4.13e-97	4	200	2	198
ASB36544.1	4.13e-97	4	200	2	198
QCD43688.1	5.36e-83	13	200	1	185

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.242596	0.755764	0.000592	0.000420	0.000277	0.000329

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001948_00189.