CAZyme Information: MGYG000001948_01461

Basic Information

• Species: Muribaculum sp002492595
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum sp002492595
• CAZyme ID: MGYG000001948_01461
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
836		94584.78	5.5734

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001948	2811075	MAG	Denmark	Europe

• Gene Location: Start: 30203; End: 32713 Strand: -

Full Sequence      

MTPKNITHLKALSSLVIALTIGLSATAAEKFIHFSRANQHDIELTNSNDTVKYDPSDWEG
VIIAVNNLRNDLKAVTGSDKASIVVGTAGKSKAVDKYTDIANRLKGKWEQYIITNDGDNV
VVIGSDKRGTIYGIYELSRQIGVSPWYWWADAPIAKHDNIFMTPGTYTDGEPAVKYRGIF
INDEWPSFGGWSQNHFGGVNSKMYSTIFELLLRLKANYMWPAMWASAFNEDDPLSPEVAD
KMGIIMGTSHHEPMMRSHREYLNRKKDVGAWDYTTNSKNLDRFFYDGMKRNKDYDNIVTI
GMRGDGDVAMGTGDDAENMKTLSRVIDGQRRIIKDIYGTEDAVPQLWAIFTEVQRYYDAR
FTVPDDVTLLFCDNNWGYIRRIGTDNERKRKGGLGMYYHIDMNGGPWNDRWVNTTTIPKL
REQLNLAYRTGIDRIWIINVGDLKPKEVPIDFIMNYAWNPDAVKPGDEKTYLENFARSIF
GEANAADIADIIAKYSKYNLIRKPEIQVPGIFNHDEMLHMDSLWTDLVEKTERIKSQISP
EARDAYYQLVYYPAVASATVAKIYNYATMGDSLAIDSLMEKDAELSDYYNTVMSNGKWNG
MMQDNHIGYTKWSIPDKNTNPLALGFKVENDINPQNDTDEYSIPAHRYSKNISGEHAKWI
FLPDLGRGEGCMGSDNVLFASADNPAKNAALEYDVDLSENGEIALGILPTQDVNPARGLR
IALQLDDADIKVIDARQGLHDEFGEYTPGNLAMSKSLKALPAPSGLLLSGWMNGRRLIRR
DEVFDNMRWLKAKFDTTPGRHKLRVIMVDPEIVLQQIVVNPDNNHYSYFGANKSTK

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	47	817	5.7e-224	0.9842180774748924

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	170	505	1	333	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	9.12e-27	642	830	10	169	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	3.95e-05	76	137	57	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EEC55419.1	0.0	50	831	54	988
QRQ50360.1	0.0	50	831	29	963
QUT25621.1	5.17e-283	22	830	64	1003
QRQ59056.1	2.59e-281	22	830	35	974
ALJ47135.1	5.88e-281	22	830	60	999

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	1.38e-166	5	834	8	849	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	3.12e-164	54	820	31	820	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	7.26e-162	54	820	30	819	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	6.52e-159	54	623	28	631	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	2.26e-113	60	622	31	654	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.235492	0.719826	0.043148	0.000663	0.000346	0.000504

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001948_01461.