CAZyme Information: MGYG000001948_02241

Basic Information

• Species: Muribaculum sp002492595
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum sp002492595
• CAZyme ID: MGYG000001948_02241
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
853		96611.84	4.9934

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001948	2811075	MAG	Denmark	Europe

• Gene Location: Start: 11127; End: 13688 Strand: -

Full Sequence      

MNAKFAICLLIAIIGLPVNAQLRVSGQPVGNSVNLGKCSILVDSLDHHLIATAAGMFADD
FHRVTGKTIPVAGSLSKNPLVIIGTPQSRYIKDLAARKMIDISEISNSPERYIIMTLQSP
FKGCDEAVVVAGSDYRGAAYGILSISERMGVSPWYWWADVPVKSLDNVYVSGKETSKSPS
IRYRGIFLNDEDWGLTPWAGKTFEPEVGNIGPRTYAKICELILRLKGNMLAPAMHACSTP
FYCNPENKVAADSFGIMITTSHCEPLLFNNASKSEWDSAVDGEWNYKTNRNTIYGKLDRR
VKEAAQYDNIYTLAMRGLHDEGMRGDMTTAEKVEMLEQAITDQREILSRYIDGDIDSIPQ
IFVPYKEAQELYESGLKVPDNVTLVWPDDNYGYIKMLSNPADRLRKGRAGVYYHVSYLGA
PHDYLWLNTTAPMLMYEELKKAYDTDADRYWLLNVGDIKPMELAVQTFFDMAWDFDRFNY
ENINRRQSAFLGSIFGDEYTPDFQEILDQYYRLAWSRKPEFMGWEREWDSPEYTGLKDPE
YSFDNYNEAVTRLKEYDGIADRCRELYDKLPAEYKASFFELLGYPVMASSQMNRKFLMSK
LNHKMTEAKEYGKANWAALQSQQAYDSINALSHKYNTQLDGKWNGMMALPIGWVALYQKM
PEVKFHDGYSPETVDLSIDKSKEIPVGYAVIPVDSYKSSNCGPGHTIRILEGIGYDWKSL
QLGEPLQPLSSIDDDSCLRVDYQLPVIDSDSITVTLYTLPRFPLYKGAESKFAMVVDGNE
PVIFDDILKEWSLDWKNQVLQNGKANKASFKIASPRKPATLSILAQDPGLIIQRIIIDYG
GLKESYIGPRPQD

Enzyme Prediction     

No EC number prediction in MGYG000001948_02241.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	37	835	1.8e-213	0.9827833572453372

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	4.32e-168	177	521	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	4.18e-18	687	849	7	170	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	0.002	61	142	44	117	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD34462.1	6.93e-295	435	853	1	419
EDV07546.1	7.29e-255	33	849	35	960
ALK86808.1	1.71e-253	40	849	43	961
QVJ80642.1	5.28e-242	30	835	17	792
APZ45930.1	2.22e-238	7	849	9	954

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BY3_A	5.68e-163	25	837	24	773	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
4C90_A	1.14e-127	28	847	39	844	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	7.22e-117	39	845	27	827	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	7.35e-116	39	845	26	826	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	3.63e-113	39	851	24	932	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000200	0.999109	0.000190	0.000156	0.000159	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001948_02241.