CAZyme Information: MGYG000001950_00529

Basic Information

• Species: Gastranaerophilus phascolarctosicola
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Gastranaerophilus; Gastranaerophilus phascolarctosicola
• CAZyme ID: MGYG000001950_00529
• CAZy Family: GT2
• CAZyme Description: Beta-monoglucosyldiacylglycerol synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
442		51140.76	8.8572

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001950	1886233	MAG	Denmark	Europe

• Gene Location: Start: 3565; End: 4893 Strand: -

Full Sequence      

MKERILLLLIILGLGVSIYIYQSYFNTVWGLALICFGMFLYGVTTTLAYKVKKRVLKYHP
EPVNENYKPFITIMIPAHNEESVISHTVANVQKIDYPHFEIIVIDDRSSDNTASVIKDLE
KKYNNLKAFIRPKDAFPGKSAVLNDAMQFAKGEAILVFDADATVEPDFLKKLVPMLEPKD
VGAVQARKVIRNKDYNLLTRCQNNEYTMDAYLQVGRDSVKGAVELRGNGELIKREALEDI
GGWNNYTITDDLDMSTRLHIKGWDIRFCIDAIVYEEGIAYILPLYRQRRRWLEGTIRRYL
EYCQDVLTSKDMSLRASLDMTIYISQFIMPGWFLLELFIRTFKCLVKDAPPHILYSSVII
GAVIGFGFFVTIRYSLRRYDNLSRRDAFIQAIQTSIYFLLIWFPLVLFISFKILFMKKDM
NWGKTAHGLVLEEEQQQAKVKA

Enzyme Prediction     

No EC number prediction in MGYG000001950_00529.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	69	292	4.5e-40	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	5.10e-62	29	427	12	424	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	1.66e-55	73	251	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
PRK11204	PRK11204	2.36e-43	52	418	38	405	N-glycosyltransferase; Provisional
cd06437	CESA_CaSu_A2	2.51e-42	69	294	1	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
cd06427	CESA_like_2	4.37e-38	69	300	1	235	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38294.1	6.62e-217	47	434	3	390
BAZ42219.1	5.27e-81	56	427	96	465
BDA68096.1	4.45e-75	63	427	100	463
AFZ00950.1	1.84e-74	63	427	101	464
AGY58232.1	1.19e-73	37	427	32	415

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	7.46e-15	60	363	119	454	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	7.88e-15	60	363	131	466	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	7.89e-15	60	363	132	467	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	4.12e-12	7	297	200	503	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5TZE_C	3.17e-08	72	177	4	109	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3MB01	2.13e-68	37	427	72	463	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
Q8YMK0	1.16e-67	37	427	72	463	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
P74165	2.46e-59	69	433	108	472	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
P96587	1.88e-30	65	294	43	279	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q6L538	8.37e-25	69	310	230	481	Probable xyloglucan glycosyltransferase 7 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC7 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	22
27	49
320	342
352	374
394	416