CAZyme Information: MGYG000001950_01502

Basic Information

• Species: Gastranaerophilus phascolarctosicola
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Gastranaerophilus; Gastranaerophilus phascolarctosicola
• CAZyme ID: MGYG000001950_01502
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		42694.93	8.8714

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001950	1886233	MAG	Denmark	Europe

• Gene Location: Start: 3355; End: 4476 Strand: +

Full Sequence      

MTKRVFIVTGEHSGDMHAAKVVEHLHAKNPDIEVEAIGGEALEAQGVKLFATHDKMSAMG
LTPKIVIDHLMLGKKLVDYLEKEYKPDLVLLIDYGTFNLNIAKFLHRAGIKVFYYIPPQV
WASRKWRLNTIKKFIDKVLCIFPFEKKMYEDKGISTEYCGHPLVSQLPEKADRKEFFIRH
GFDPDKKLVSIFPGSRKFELKQLMNVFVVSAKELQHRHPELQFCISHAPNLKDDVYSQYL
KDTEFKVIKGENQQLLSVSDALILASGTVALEATLYQTPMLIAYRGPWFFYLVYLLVRCI
KRVSLPNIIADKEIVKEIIQGKVSVHNIVNETEKLLYDESYRANHINDLGKIKSMLSDKV
SSEEVAKIIVNSL

Enzyme Prediction     

No EC number prediction in MGYG000001950_01502.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	5	356	1.8e-107	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	8.32e-117	3	373	2	375	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	5.54e-102	3	370	2	376	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.75e-76	5	344	1	347	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.33e-66	5	328	8	337	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	6.49e-46	11	372	10	347	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39331.1	1.08e-197	3	373	2	372
QMU61387.1	8.56e-76	2	368	10	379
AJF06888.1	2.24e-71	3	368	11	380
AEG01383.1	4.63e-71	5	373	10	381
QOZ87412.1	1.16e-70	4	369	2	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.12e-40	5	320	9	329	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.12e-40	5	320	9	329	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B6J161	5.35e-69	3	371	4	372	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
A9KC41	7.54e-69	3	371	4	372	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1
A9NCA7	1.06e-68	3	371	4	372	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) OX=360115 GN=lpxB PE=3 SV=1
Q83DS5	1.06e-68	3	371	4	372	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1
Q1D393	2.01e-67	4	373	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001950_01502.