CAZyme Information: MGYG000001951_00203

Basic Information

• Species: CAG-873 sp900548975
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900548975
• CAZyme ID: MGYG000001951_00203
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
984		111689.73	5.4528

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001951	2929441	MAG	Denmark	Europe

• Gene Location: Start: 24835; End: 27789 Strand: -

Full Sequence      

MKLLRSLMQAVMLLLLSESVFADVTLTSKSNGPDIFTIVGKGAPATVYYDPGDFEVVKTT
AELFAGDVKAVSGKEIPVSDISGTPTGNIIIVGTAGNNARLAELERKGKIDLRPVKAGWE
KYMITLVDKPYPGVGKALIVAGSDRRGTAYGLLGISRTIGVSPWYWWLDAPVRHADNIYI
KVEPFVSEEPSVKYRGIFINDEDWGLYRWAKENFDKEFGNIGPRTYEKVCELLLRLQANY
LCPAMHDATTAFHTVPENRAIADRYAIVMGSSHCEPLLFNTASEWHRDRYGEWDYIGNRT
GVDSVLNARAAEIAPYENVYTLALRGLHDRSMNASNDMTERKDMLQQALLSQRRMIARHT
GKAPEEIPQAFTPYKEVLDVYDKGLDLPDDVTIIWPDDNYGYMKRLSSPAEQKRAGRSGV
YYHASYLGKPHDHLWMHTASPTVMYEELRKAYDMTADRIWLLNAGDIKSCEFAVDFFLAM
AFDIESFNFDRAARYRTEWLCGMLGDRFAREYADMSDSFYRLAFTRRPEFMGWGYLWSTD
KHWRERNTDTDFSLTNYREADRRIEEYRRIGHMADSILGSMSDEKERACFYQAMYYPVKG
CELLNRMVLDGQRNRLYAESGRPSAKRYAQSAKNCYDSLRHITDGYNSLLDGKWDHVMTM
EQGFASAYFELPELREAKDSPEDQIGVSAEQEDWIKGRNAYHILPAFNYYLPGTYYVDVF
NRRDTPIKWEATVSDSWINISKSSGNSTDERVEVSVDWSRLPDTENAAGYIDFSAGEAGS
QRVLVSAFRPVVHDNDITESMYMENNGYIAIEAAGFHRKTENSDITMTVAPYLGCENYGV
QLGNPAAPQQRTMGENTPRLEYDFYTFSQGSVDVYTYVLPVFTLNNDRGYAGHEQTNSET
KYGVCIDDGPVMNPSTSSVEYAQIWYESALKNSRINKTTLNIDKPGKHTVKIICGDAGTV
IQKIVLDFGGMKRSYMGPQPTKIK

Enzyme Prediction     

No EC number prediction in MGYG000001951_00203.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	36	672	6.8e-211	0.8350071736011477

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	2.04e-151	189	530	2	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	1.07e-47	802	978	2	170	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam05124	S_layer_C	1.00e-04	88	149	151	211	S-layer like family, C-terminal region.
cd14948	BACON	1.04e-04	713	786	16	81	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ59884.1	0.0	1	982	1	983
QUT89091.1	0.0	1	982	1	983
EDV06188.1	0.0	1	982	1	983
QDO71503.1	0.0	5	982	3	981
QUT40903.1	0.0	26	982	23	981

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	8.59e-140	45	981	23	933	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
5BY3_A	1.27e-125	38	655	21	612	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
4C90_A	5.92e-99	36	710	44	692	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	8.34e-98	26	662	7	629	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	2.95e-96	26	662	6	628	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000254	0.999076	0.000189	0.000170	0.000157	0.000150

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001951_00203.