CAZyme Information: MGYG000001951_01545

Basic Information

• Species: CAG-873 sp900548975
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900548975
• CAZyme ID: MGYG000001951_01545
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
766		83706.24	5.2167

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001951	2929441	MAG	Denmark	Europe

• Gene Location: Start: 2929; End: 5229 Strand: +

Full Sequence      

MRRILTFVMIFLGLGALHSCTATKETPAEAPFEVHWSVENLGPDSTGRHYRQSLRLVGDL
RGVERLAFNQFARRMTPSDPADTIIEIVPGYYALGSSRFAGADGSDTLDVDIVTSGALYS
LRYAPEGFHAVMADGRVLPVRLVQADILADPRGYTSGSRDYMPYGDAVYARNEEIAGGTA
GVYDVVPSFKEVRTGAGSSVVDLDNIEFAEPAEAPADGEYRVTVGGGRMRVEAPRAMWPR
LRLRLRHNFGSGRRELPDAVITDRPALEYRGLMVDVARNFQQPEEIHRVLDMMAVYGLNT
FHFHLVDDEAWRLEIPPLPELTEMGGRRGYTPGSDGTFLPQIFGGDGNPASATSNNGYIS
RADYIDIIRHADSLGIAVIPEIESPGHGRAAIRAMELRARRTGDNSLLMSEAADTSRYTS
AQSFHDNVMNPALEGTYKLMNTVADEIAAMHREAGVPLKAIHIGGDEVPRGAWSGSPSVA
AMMEREGMTTEKEVHAAFVRRVASDFAAKGIAISGWQEIALRHPEDYNEAVRPQVYSVNC
WSTLASQGAGGVVEAVAKAGYPVVLSNVNHFYLDMCYSRHPYERGLTWGGTTDEFSALAG
YPARLCPFEGVNLKGVQGQVFAETIRDRGNLETMLFPKMLGLAERGWNPDSTYSEADFHA
VILREIPKWEAAGLTYHVRQPGLIVEDGRYVKVNSPYPDAVVRVSFDGSGPDENSPELKP
GEVFDLTTLPEAPKQIRARLWLNGHPSVATLARPVQPAPGGEPGGE

Enzyme Prediction     

No EC number prediction in MGYG000001951_01545.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	266	649	1.6e-87	0.9614243323442137

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06569	GH20_Sm-chitobiase-like	2.88e-149	263	670	1	439	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
cd06563	GH20_chitobiase-like	4.14e-105	268	658	2	353	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	9.63e-100	268	649	2	345	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
COG3525	Chb	4.08e-78	243	750	235	723	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd02742	GH20_hexosaminidase	4.28e-62	269	647	1	302	Beta-N-acetylhexosaminidases of glycosyl hydrolase family 20 (GH20) catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides. These enzymes are broadly distributed in microorganisms, plants and animals, and play roles in various key physiological and pathological processes. These processes include cell structural integrity, energy storage, cellular signaling, fertilization, pathogen defense, viral penetration, the development of carcinomas, inflammatory events and lysosomal storage disorders. The GH20 enzymes include the eukaryotic beta-N-acetylhexosaminidases A and B, the bacterial chitobiases, dispersin B, and lacto-N-biosidase. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by the solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM10820.1	5.30e-179	14	754	7	747
AHF12728.1	7.29e-131	12	750	13	829
QUU00208.1	1.29e-121	9	715	11	801
BBK89309.1	1.74e-121	68	715	55	786
CDL66413.1	2.32e-121	245	750	29	556

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QBA_A	2.22e-64	250	738	296	855	BACTERIALCHITOBIASE, GLYCOSYL HYDROLASE FAMILY 20 [Serratia marcescens],1QBB_A BACTERIAL CHITOBIASE COMPLEXED WITH CHITOBIOSE (DINAG) [Serratia marcescens]
6EZR_A	2.41e-64	261	676	257	637	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZR_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZS_A Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6EZS_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6K35_A Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi],6K35_B Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi]
1C7T_A	5.67e-64	250	738	296	855	ChainA, BETA-N-ACETYLHEXOSAMINIDASE [Serratia marcescens]
1C7S_A	2.70e-63	250	738	296	855	ChainA, BETA-N-ACETYLHEXOSAMINIDASE [Serratia marcescens]
6EZT_A	2.97e-63	261	676	254	634	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi],6EZT_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q04786	1.56e-71	252	708	300	809	Beta-hexosaminidase OS=Vibrio vulnificus OX=672 GN=hex PE=3 SV=1
P13670	2.38e-70	256	724	321	865	N,N'-diacetylchitobiase OS=Vibrio harveyi OX=669 GN=chb PE=1 SV=1
Q54468	2.25e-63	250	738	323	882	Chitobiase OS=Serratia marcescens OX=615 GN=chb PE=1 SV=1
P49007	6.21e-59	256	648	316	727	Beta-hexosaminidase B OS=Pseudoalteromonas piscicida OX=43662 GN=nag096 PE=3 SV=1
P96155	1.50e-57	256	646	249	604	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000109	0.999949	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001951_01545.