CAZyme Information: MGYG000001951_01655

Basic Information

• Species: CAG-873 sp900548975
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900548975
• CAZyme ID: MGYG000001951_01655
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
281		31176.2	5.5779

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001951	2929441	MAG	Denmark	Europe

• Gene Location: Start: 555; End: 1400 Strand: -

Full Sequence      

MKKLFAAAMALAGAIAVFAQDSKVINAEMPSAVLGQNKTYTVYLPAGYDSSADRYPVLYL
LHGAWGNDRDWSEKGTMKELTDLAIKNGTAVPMIVVMPDARGVDENFGGERMGYFSVPGW
DYERYFFDELMPHIDSTYRTIPDKKHRAIAGLSMGGGGTVVYAQKHPDLWAAACSLSGLV
GLTAQRHSEDTDYAKSLAANDPVIFLENASEDTLGQLRTVRWFADCGDDDFLADSNLAFY
TAMRHKGIPIEYRMRDGAHNWTYWRTALPEVLRFSSSAFTH

Enzyme Prediction     

No EC number prediction in MGYG000001951_01655.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	31	277	8e-62	0.986784140969163

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00756	Esterase	1.17e-31	31	274	1	245	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2382	Fes	1.41e-31	30	274	74	294	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
COG0627	FrmB	5.02e-29	31	274	28	307	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG4099	COG4099	1.52e-07	40	209	176	334	Predicted peptidase [General function prediction only].
COG2819	YbbA	3.52e-07	28	276	13	259	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJW91289.1	1.07e-34	30	271	145	384
ABR43742.1	1.07e-33	31	279	145	388
QJE30861.1	1.07e-33	31	279	145	388
BBK92061.1	1.07e-33	31	279	145	388
QIX63945.1	1.07e-33	31	279	145	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VOL_A	7.99e-79	21	279	9	272	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
6RZN_A	3.88e-31	31	270	139	379	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
7B5V_A	7.71e-23	42	268	157	377	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6RZO_A	1.19e-21	42	265	135	332	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_B	1.20e-21	42	265	135	332	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	2.50e-25	42	272	449	665	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
D5EY13	3.54e-20	35	271	511	720	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P10478	3.76e-17	23	157	50	176	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P9WM39	7.26e-16	21	182	171	323	Esterase Rv1288 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1288 PE=1 SV=1
P9WM38	7.26e-16	21	182	171	323	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000296	0.998982	0.000197	0.000174	0.000170	0.000153

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001951_01655.