CAZyme Information: MGYG000001951_01656

Basic Information

• Species: CAG-873 sp900548975
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900548975
• CAZyme ID: MGYG000001951_01656
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
782		86579.98	4.7543

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001951	2929441	MAG	Denmark	Europe

• Gene Location: Start: 1397; End: 3745 Strand: -

Full Sequence      

MKKLLWPAVALAAAACTHSPAEKAQPVPVTAFPVENVRLTDGPFRHAQDLDLDYLLALDP
DRLLAPYLKEAGLQPKAENYPNWENTGLDGHIGGHYLSALAYMYAATGNEEIGKRLDYVL
AELRRCADAAGDGYICGVPGGRQMWREVAEGDIRAGGFDLNSRWVPLYNIHKTYAGLRDA
WLQAHRTDARDMLVGLTDWMMAEVSQLSDEQVQEMLRSEHGGLNEIFADVAAITGDDKYL
ALAHRFSHNDVLEPLLNGEDRLTGMHANTQIPKVIGFKRIADIEGNAAWDSAADFFWKDV
TSKRSVSIGGNSVREHFHSPDDFSSMLESEQGPETCNTYNMLRLTRMLYQSSGDPSYMDY
GERAIFNHILSSQNHDNGGFVYFTPMRSGHYRVYSQPQTSFWCCVGSGLENHARYGEYIY
AADADSNIYVNLFIPSVLTWNGNTLEQRTDFPASPVTSIIVNPASEGEFAVKVRVPQWTN
PDSVVLAVNGKTEKPQINAGYLSVDRTWAPGDSIAVTLPMYLHAEQLPDSSANYSFLYGP
MVLAADLGSESQEGLMADDSRGGHIAAGPRLPLQNMPVIVTESSDIASCLEPVPGEPLAF
TMHGVYPAKYDGMRLVPFSSLNECRYMVYWSVMTPDELDGKLAAIAEEQQRRDALDALTA
DMVICGEQQPESDHFVKMDRSETGYDGDLHWRRASRDGWFSYSFNPKGRKADRIVVSYGP
DKMRHADIFLDGTKIGSFGGDGTSPAEFPVNIAGNSQHIIKVVASDNSDSPNVYEIRLMK
NQ

Enzyme Prediction     

EC	3.2.1.185

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	36	544	5.7e-205	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	36	544	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.37e-114	17	548	2	505	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	6.21e-35	548	630	1	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABR38200.1	0.0	26	779	25	781
QQY39509.1	0.0	26	779	25	781
ALK86774.1	0.0	26	779	25	781
QEW35204.1	0.0	26	779	25	781
QJR69771.1	0.0	26	779	25	781

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	6.90e-273	29	735	25	750	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	3.77e-262	29	735	25	750	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	3.25e-21	234	520	206	517	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	3.73e-19	285	520	284	532	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.98e-18	285	519	284	531	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000046	0.999987	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001951_01656.