CAZyme Information: MGYG000001951_02092

Basic Information

• Species: CAG-873 sp900548975
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900548975
• CAZyme ID: MGYG000001951_02092
• CAZy Family: GT30
• CAZyme Description: 3-deoxy-D-manno-octulosonic acid transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427		47096.11	9.1456

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001951	2929441	MAG	Denmark	Europe

• Gene Location: Start: 10461; End: 11744 Strand: +

Full Sequence      

MNPLYTAGIAVYGGAARLVSLGSPKVRHMLHGQSETIRRLDAFRRAMAPDGFDVWFHAAS
LGEFEQARPLIDALLARDPSKSILLSFFSPSGYEVRCDYNPRVAVVYLPFDTPRNVDAFL
DAARPRMAVFVKYEFWGNYLERLKKRNIPTYIISAIFRPSQRFFKPWGSMFRRMLGNFEH
LYVQDEGSRRLLAGIGIENVTVAGDTRFDRVTAIRLNRKAIPEIECFLGAGGGKRFTIVF
GSSWERDENVYIPWLEAHAGVKAIIAPHEFDKNRLAAMRRRLGSDRTMLFSDFRRIYASS
PEAAAEAAGKLSCLIIDCFGLLSSLYAYADVAYVGGGFGAGIHNINEAATYGVPVLFGPR
HSKFKEAADLIACGGAFSVDGAAAFDAAMTPLLDDSLRKKAGKAAGDYIAANIGASDIIM
ADIFPQI

Enzyme Prediction     

No EC number prediction in MGYG000001951_02092.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT30	48	210	2.3e-47	0.9378531073446328

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1519	KdtA	8.88e-61	49	427	47	419	3-deoxy-D-manno-octulosonic-acid transferase [Cell wall/membrane/envelope biogenesis].
PRK05749	PRK05749	2.28e-59	49	427	48	421	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed
pfam04413	Glycos_transf_N	1.39e-57	49	210	11	176	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36286.1	3.66e-149	1	426	1	410
QQR08145.1	1.81e-143	1	416	1	401
ASB37412.1	1.81e-143	1	416	1	401
ANU64487.1	1.81e-143	1	416	1	401
BCI64150.1	7.49e-137	1	424	1	407

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q45374	1.67e-30	45	416	46	416	3-deoxy-D-manno-octulosonic acid transferase OS=Bordetella pertussis OX=520 GN=waaA PE=1 SV=1
P0AC77	5.75e-27	39	427	38	420	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O157:H7 OX=83334 GN=waaA PE=3 SV=1
P0AC76	5.75e-27	39	427	38	420	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=waaA PE=3 SV=1
P0AC75	5.75e-27	39	427	38	420	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli (strain K12) OX=83333 GN=waaA PE=1 SV=1
P44806	9.58e-22	18	415	23	411	3-deoxy-D-manno-octulosonic acid transferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=waaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999999	0.000048	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001951_02092.