CAZyme Information: MGYG000001955_00289

Basic Information

• Species: Frisingicoccus sp900549105
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Frisingicoccus; Frisingicoccus sp900549105
• CAZyme ID: MGYG000001955_00289
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
831	MGYG000001955_3|CGC1	96155.87	7.1274

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001955	2599046	MAG	Denmark	Europe

• Gene Location: Start: 4657; End: 7152 Strand: -

Full Sequence      

MSNMKWHIESVSCDLKRKPQLELSGWIIEKQGEKVDFQVMADNGKHVPFFVTWEKRRDVT
KAVKAAKGQKTPGFCMQIDDIRSLFKVYRELKLYAVTETEKKCIYSRKFSEIYKDYKAGT
LDLCIDKVTLQGKKVIVTGWMYSKLGKEVFNVCDGKGKPVNYTMERTSRPDVLAALKIKE
DKMLGVEIILNVDDIDGQRFSICVKNKATQKKYSVNLRKVAFDATLPGRCWNAIGPRQLL
WNMRYIKHHGLIEFKHEMGKKIRGVSTDYEIWLKKKQLSEAELERERNEKFEICPKYSIV
IPLYNTPLNYLEELIESIVGQTYGNFQLCLADGSTQEDVGDFIRKKYEEDSRIVYRKLTE
NRGISMNTNEAIDMADGDFIMLCDHDDTIALNTLYEMTKAVNENPEIDVIYTDEDKVTMD
GKHYFEPHFKPDFNLDYLRSTNYICHIFVVKKTIVDEVGTLRSKYDGAQDYDFILRCCEK
AKVIHHIPKVLYHWRSHPASTAGNPESKLYAYEAGRKAVEAHYKRLGIDAAVVMTENYGH
YRTQFTIEGQPLISIIIPNKDQIRMLDNCLTSIYEKTSYKNYEIIIVENNSTEEKTFKYY
EMAAKRHSNLRVITWKDEFNYAAINNYAAPYAKGDYLLLLNNDVEVITPTWLEEMLGYCQ
REDVGVVGARLMYNDNAVQHGGVIIGLGESRTAGHIVGDYHYPELTYQEKMRSAQDLSAV
TGACLMTKKSIYQELGGLDEEKFKVAFNDVDYCLRVRELGKLVVYNAYVSLYHHESVSRG
YEQKSGNVQRFEREVQNFKERWGAFIEKGDPYYNENMTLDSGYCTVRLTSN

Enzyme Prediction     

No EC number prediction in MGYG000001955_00289.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	298	458	1.2e-22	0.9882352941176471
GT2	554	735	6.6e-22	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	5.27e-97	295	495	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	4.74e-39	555	775	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd06433	GT_2_WfgS_like	4.62e-25	298	501	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.72e-24	549	780	1	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd00761	Glyco_tranf_GTA_type	4.29e-20	299	486	1	156	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL24562.1	1.60e-235	1	827	1	810
QJU23131.1	7.18e-224	125	819	5	705
QIX91353.1	8.15e-223	125	819	5	705
ASN97860.1	4.62e-222	125	819	5	705
QRP37330.1	4.62e-222	125	819	5	705

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1H7L_A	6.50e-09	295	412	1	124	dTDP-MAGNESIUMCOMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1H7Q_A dTDP-MANGANESE COMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1QG8_A Native (Magnesium-Containing) Spsa From Bacillus Subtilis [Bacillus subtilis],1QGQ_A Udp-manganese Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis],1QGS_A Udp-Magnesium Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	6.82e-126	272	820	344	891	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	3.59e-87	267	827	291	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	1.52e-14	295	477	8	194	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
Q92IF9	2.41e-10	298	643	17	381	Uncharacterized glycosyltransferase RC0461 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=RC0461 PE=3 SV=1
P9WMX7	7.69e-10	294	477	3	181	PGL/p-HBAD biosynthesis glycosyltransferase Rv2957 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2957 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001955_00289.