CAZyme Information: MGYG000001955_01829

Basic Information

• Species: Frisingicoccus sp900549105
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Frisingicoccus; Frisingicoccus sp900549105
• CAZyme ID: MGYG000001955_01829
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
232		26635.02	4.8894

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001955	2599046	MAG	Denmark	Europe

• Gene Location: Start: 11762; End: 12460 Strand: +

Full Sequence      

MKLIWKSIKLVIFCKLLKMMMGIGLLVFSIFMFKGYSDYKDALEKKPLAQAMEEIVQKPS
YVSLEQVPDIYKQALVAVEDHRFYDHMGVDVIATGRAVINDIKAMDFVEGGSTITQQLAK
NMYFSQEKTLDRKAAEMFMALKIEREYSKEEILEAYINSIYYGEGYYSLREASLGYFGKE
PWDMTDDECTLLVGVPNAPAVYAPSVDMEMARKRQRQVLSMMQQNEVLAEVN

Enzyme Prediction     

No EC number prediction in MGYG000001955_01829.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	54	223	3.9e-61	0.96045197740113

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	2.36e-81	56	223	10	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	2.71e-72	61	225	4	168	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.89e-71	1	228	9	246	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	6.80e-60	1	225	2	233	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK13481	PRK13481	9.54e-44	12	231	7	232	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU22158.1	2.07e-76	34	219	28	213
QRP41835.1	4.16e-76	34	219	28	213
ASN93505.1	4.16e-76	34	219	28	213
ANU46909.1	4.78e-75	34	219	28	213
QQQ98385.1	4.78e-75	34	219	28	213

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	1.20e-44	56	222	17	183	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	4.77e-44	56	222	17	183	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
3HZS_A	2.83e-32	33	202	4	170	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	2.90e-32	33	202	5	171	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]
5ZZK_A	3.86e-31	52	202	50	206	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O66874	1.50e-41	23	222	17	226	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
P38050	2.46e-40	62	222	70	230	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
P70997	9.88e-39	57	230	72	245	Penicillin-binding protein 2D OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpG PE=2 SV=3
O87626	3.73e-36	57	222	66	231	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
P39793	4.04e-36	39	230	75	267	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999964	0.000017	0.000004	0.000000	0.000000	0.000045

TMHMM  Annotations     

start	end
11	33