CAZyme Information: MGYG000001957_00219

Basic Information

• Species: UMGS268 sp900540705
• Lineage: Bacteria; Firmicutes; Bacilli; Acholeplasmatales; Anaeroplasmataceae; UMGS268; UMGS268 sp900540705
• CAZyme ID: MGYG000001957_00219
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
431		50472.78	8.4871

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001957	1806938	MAG	Denmark	Europe

• Gene Location: Start: 28535; End: 29830 Strand: -

Full Sequence      

MDILFYVSVGVIALATIAFLSAYRRRLVWWFTCSKPQKRTQYDKNHKLAIVIPARNEGKT
VLPLIESLLNQTYDKQCFDVHVVVKEKQDPTIDMIKEIMPTAFFYVDEKQKTKGHALDYC
MKEICKEKKGYYDAFIIIDADCLLDEKFLSEMNNALGSGKDVYNSKLVVKNYLNHDKKSN
SWASRCNGMIWTLMSELGNRAKSDRGITTMVLGTGLMIRSSLVESWNGWPYQQTLTEDIE
LQRSCALHHYSTEYVSYAVCYVEESTSLHVSNIRRQRWMSGVVHCDRIYDDKLRENIKTK
EDKLNFYSFHCLYYVYWYFGFLCLATIFSLALGTILHFDHSPLSTYYFALAGCSIGIIYL
GMLLMTIRCMVVDRKYMRMNFFTRIWICLTHPLYYMGYIGVMIKCFALKQKVDWKRIERV
QFQEGAFEKTE

Enzyme Prediction     

No EC number prediction in MGYG000001957_00219.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	48	280	1.4e-24	0.9782608695652174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	3.44e-29	50	241	1	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
COG1215	BcsA	1.20e-22	3	422	15	427	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	2.14e-21	50	238	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam13641	Glyco_tranf_2_3	3.09e-16	48	281	4	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd00761	Glyco_tranf_GTA_type	1.92e-11	50	156	1	102	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE15924.1	1.86e-110	8	421	3	414
QNL97367.1	1.19e-52	10	421	14	441
QWT55360.1	1.58e-35	35	289	36	282
ANU40170.1	3.78e-32	37	289	39	284
QQR07059.1	3.78e-32	37	289	39	284

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
4	23
313	335
345	367
380	402