CAZyme Information: MGYG000001957_00732

Basic Information

• Species: UMGS268 sp900540705
• Lineage: Bacteria; Firmicutes; Bacilli; Acholeplasmatales; Anaeroplasmataceae; UMGS268; UMGS268 sp900540705
• CAZyme ID: MGYG000001957_00732
• CAZy Family: GH39
• CAZyme Description: HTH-type transcriptional activator RhaS

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
820	MGYG000001957_11|CGC1	96567.32	6.9209

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001957	1806938	MAG	Denmark	Europe

• Gene Location: Start: 25035; End: 27497 Strand: +

Full Sequence      

MLLKYNFLNFPSDFPINISLKKVTNQESDWHTKVKILYILEGSATLTMQHQTYSFSPDEI
VLINPWTIYDIFTEKEIAYLELEIDFLKFDFSSSDIDKLLFELNSSNDLDKEKYGVIKAV
IFSLIQVNTMQNANVSYINKSLAYQLLFTLMNQFKVESNVRRAVSQKHLLKLKEILDYIE
KNYKTAPSLTDIASHFGYTPQYFSAFFNKQMNQNYQTYLDTLRINKNFHLLHNSDITLED
IASASGFYDYRSYIRAFKNIYHMTPSEFRKNKNQGESAQKLSFSAKEVNHYLDILYKNKI
CKLEEITAKIDQNIEISIDYEKKGEKIKKTFLNMIGVNRASDLLRQNVRAMLEQAQKEIG
FKMIKFQGLFSDELHVYRKFVNGEKSISFVFIDQIFDYIKSINLKPFLQLSYMPRDMAKD
KNKIVFESKFIASEPDNMEDWLLLVHTFITHMIQKYGIDEVLSWPITIWHEPDSSVHAFG
FKSDDLFFEFYRKTFETLKEISPKFIVGTPNLIPFASWAMDWDKRFLKYTQQMGCYPDFL
NVTYYSNDFDFFITGKKLEKLSKNPDNLKEYIKKIKDPKFFKGNTIYLSEWSITTNQRNL
INDTIFASCYFTKNILENMDSLDSFTKWGLTDFIDQTQLPNQTYHGGSGLFTYNGICKAQ
YSALKFLSRLDDIVLEAGDGYYITRGRETIKIIIYNYLHYSDLFADGEYFSIQSHSRYEP
FQMNRTKKYSFHFENINFIHAKIKVSRITQESGSSYDIYESMSNLEFENIDETADLKKLS
TPKYILFERHIEDNTLDISASVQALEVKLIEIRFYKNRPL

Enzyme Prediction     

No EC number prediction in MGYG000001957_00732.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	325	763	1.9e-86	0.9791183294663574

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	1.07e-46	314	677	1	357	Glycosyl hydrolases family 39.
COG3664	XynB	1.01e-21	343	815	1	427	Beta-xylosidase [Carbohydrate transport and metabolism].
COG2207	AraC	1.51e-21	158	274	8	124	AraC-type DNA-binding domain and AraC-containing proteins [Transcription].
pfam12833	HTH_18	2.63e-17	192	271	1	81	Helix-turn-helix domain.
smart00342	HTH_ARAC	5.67e-17	187	269	2	84	helix_turn_helix, arabinose operon control protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ51292.1	2.59e-165	4	812	4	832
QUF72222.1	5.08e-152	1	817	1	839
ABR35186.1	5.08e-152	1	817	1	839
AIU02488.1	5.08e-152	1	817	1	839
AQR95414.1	5.43e-150	1	813	1	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1W91_A	1.33e-43	325	812	12	480	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]
2BS9_A	1.12e-42	325	812	12	480	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
2BFG_A	6.93e-42	325	812	12	480	crystalstructure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_B crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_C crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_D crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_E crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_F crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_G crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_H crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus]
4M29_A	2.78e-39	316	764	11	448	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]
4EKJ_A	5.07e-39	316	764	11	448	ChainA, Beta-xylosidase [Caulobacter vibrioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZFM2	5.22e-41	325	812	12	481	Beta-xylosidase OS=Geobacillus stearothermophilus OX=1422 GN=xynB PE=1 SV=1
P23552	1.82e-40	314	671	7	357	Beta-xylosidase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynB PE=3 SV=1
O30360	8.20e-36	335	812	22	479	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=xynB PE=3 SV=1
P36906	2.01e-35	335	812	22	479	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynB PE=1 SV=1
Q6GKK1	6.51e-13	38	817	27	744	Uncharacterized HTH-type transcriptional regulator SAR0107 OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=SAR0107 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001957_00732.