CAZyme Information: MGYG000001957_00829

Basic Information

• Species: UMGS268 sp900540705
• Lineage: Bacteria; Firmicutes; Bacilli; Acholeplasmatales; Anaeroplasmataceae; UMGS268; UMGS268 sp900540705
• CAZyme ID: MGYG000001957_00829
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309	MGYG000001957_13|CGC2	35132.87	6.2335

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001957	1806938	MAG	Denmark	Europe

• Gene Location: Start: 36018; End: 36947 Strand: +

Full Sequence      

MNYEITNSQSIKDCLLKMQAGDTLILDDGVYQGKFEIWNSGIKIKAKNPGKAILSNKDYY
HKIMPNHNECNTFNTFTLYIGGDDVTLEGLTIKNEATPSNVYGQAVALHVDGNNFRCQNC
SILSAQDTLFTGPMPKDLIERYQGFYPEERLKGLPSVQCYENCIIAGDVDFIFGSATALI
KYCDILSIEREGDTPTYVCAPSHPKELPYGYLFYQCNFKGTKGLAYLGRPWRDYGCAAFI
LCNLGKHIHPLGFNKWNNTNRDKTARFYEYTLNTDLSLREKWAVQLSEEEAFKYVDDFLA
FMKENSSKK

Enzyme Prediction     

No EC number prediction in MGYG000001957_00829.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	17	295	2e-60	0.9027777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	4.35e-46	29	294	120	396	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	9.60e-32	71	299	75	295	Pectinesterase.
PLN02773	PLN02773	1.65e-31	42	295	57	291	pectinesterase
PLN02432	PLN02432	1.23e-25	71	291	82	277	putative pectinesterase
PLN02708	PLN02708	1.10e-24	72	299	319	543	Probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEI32806.1	1.13e-62	29	294	36	306
ADZ22413.1	1.13e-62	29	294	36	306
AAK81304.1	1.13e-62	29	294	36	306
AWV81030.1	1.13e-62	29	294	36	306
QEN03925.1	2.83e-60	24	284	38	307

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	4.90e-13	72	282	79	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	5.77e-13	9	294	19	328	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
3UW0_A	6.46e-13	10	269	46	327	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
1GQ8_A	4.10e-12	72	270	83	266	Pectinmethylesterase from Carrot [Daucus carota]
4PMH_A	3.09e-11	85	231	159	292	Thestructure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.65e-22	72	295	91	291	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9LXD9	1.39e-21	72	294	317	535	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1
Q9ZQA3	2.81e-20	6	296	102	375	Probable pectinesterase 15 OS=Arabidopsis thaliana OX=3702 GN=PME15 PE=2 SV=1
Q8L7Q7	1.14e-18	72	296	367	584	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2
O22149	1.09e-17	7	270	216	459	Probable pectinesterase/pectinesterase inhibitor 17 OS=Arabidopsis thaliana OX=3702 GN=PME17 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001957_00829.