CAZyme Information: MGYG000001958_00235

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Intestinimonas
• CAZyme ID: MGYG000001958_00235
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
305		32283.43	4.0177

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001958	1726878	MAG	Denmark	Europe

• Gene Location: Start: 71; End: 988 Strand: +

Full Sequence      

MESARQLVDLTNGLKALAGSGVPLFLSTDQEGGLVERMPPEIEKLPNAYDVSDPAAFGST
LGAECAAFGLNTDFAPSLDIWSNPNNTVIGRRAFGSDAETVTQRGLACLTAMEESGTIPV
IKHFPGHGDTDTDSHVGLPVVDKTREELLEMELLPFRAAIDAGVPAVMVGHILMTQIDPD
RPATLSSEVVTGLLREELGFDGVVFTDDLTMGAITQNYGLGEAAVLAVEAGCDVLLVCHE
TGSVEEVYTALLDAVDAGRITVDRLDQSVRRILTPKQNYGLTNDPVDLPDLDALNARVAA
VNGLV

Enzyme Prediction     

No EC number prediction in MGYG000001958_00235.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	20	237	3.6e-55	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	2.32e-74	2	305	41	339	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	5.73e-73	2	274	43	315	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	3.60e-49	2	261	37	303	beta-hexosaminidase; Provisional
PRK15098	PRK15098	1.12e-17	64	305	145	396	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA31937.1	1.83e-130	1	301	104	425
ALP95074.1	1.52e-129	1	301	107	422
QBB66908.1	6.13e-129	1	301	107	422
QQR04853.1	3.22e-125	1	301	104	421
ANU42253.1	3.22e-125	1	301	104	421

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	3.94e-74	6	281	58	342	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	6.44e-63	1	281	96	398	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.20e-62	1	281	70	372	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	3.78e-62	1	281	100	402	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
3TEV_A	3.75e-55	1	255	54	306	Thecrystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1],3TEV_B The crystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	3.53e-62	1	281	96	398	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	8.72e-50	1	299	74	410	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q0AF74	4.04e-45	2	269	39	317	Beta-hexosaminidase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=nagZ PE=3 SV=1
L7N6B0	5.66e-43	17	276	110	380	Beta-hexosaminidase LpqI OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lpqI PE=1 SV=1
A0A0H3M1P5	1.55e-42	17	276	110	380	Beta-hexosaminidase LpqI OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) OX=410289 GN=lpqI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001958_00235.