CAZyme Information: MGYG000001959_00088

Basic Information

• Species: UBA3631 sp900546275
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; UBA3631; UBA3631 sp900546275
• CAZyme ID: MGYG000001959_00088
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
221	MGYG000001959_1|CGC1	25367.2	8.3243

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001959	1132371	MAG	Denmark	Europe

• Gene Location: Start: 87771; End: 88436 Strand: -

Full Sequence      

MNFIRKIILVAFCIFFIVCTYLLVNGYSLYKSVLKETSLEEKINEIRNKEDYTKIEDVSP
DFLNAIVAVEDHRFYKHNGVDLISTVKAIFTNVKASSYVTGGSSITQQLAKNMYFSQEKK
MVRKIAEMFMAYNLEKNLSKNEILELYINNIYYGSGYYSVYSASMGYFNKKPSELTLDEA
SLLAGIPNAPSIYSLDVNPTLARQRQKQVISAMKEYNYIND

Enzyme Prediction     

No EC number prediction in MGYG000001959_00088.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	43	214	3.1e-62	0.9717514124293786

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	2.74e-67	47	214	10	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	6.31e-65	52	219	4	171	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	5.55e-57	51	221	77	248	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	8.61e-55	1	219	2	236	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG4953	PbpC	6.08e-41	53	213	61	220	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO38940.1	1.55e-72	24	221	28	225
SET89048.1	4.07e-71	2	220	5	223
QJU22158.1	5.59e-71	24	221	27	224
QRP41835.1	1.59e-70	24	221	27	224
ASN93505.1	1.59e-70	24	221	27	224

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	1.51e-42	52	219	22	189	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	6.01e-42	52	219	22	189	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
3UDF_A	2.02e-36	58	220	47	209	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
5ZZK_A	5.03e-36	28	221	32	234	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	5.39e-36	41	221	12	198	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5FAC7	3.51e-41	49	219	67	237	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=mrcA PE=3 SV=3
P0A0Z6	3.51e-41	49	219	67	237	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=mrcA PE=3 SV=1
P0A0Z5	3.51e-41	49	219	67	237	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=mrcA PE=3 SV=1
O05131	3.51e-41	49	219	67	237	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae OX=485 GN=mrcA PE=1 SV=3
O87579	4.80e-41	49	219	67	237	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.860790	0.013916	0.122281	0.000095	0.000052	0.002881

TMHMM  Annotations     

start	end
7	29