CAZyme Information: MGYG000001960_01052

Basic Information

• Species: QAMI01 sp900551915
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; QAMI01; QAMI01 sp900551915
• CAZyme ID: MGYG000001960_01052
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376		42758.34	9.7773

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001960	2057960	MAG	Denmark	Europe

• Gene Location: Start: 9807; End: 10937 Strand: +

Full Sequence      

MKKVFIITGEHSGDIHASMVAKRLFELNHDIEIEGIGGENLKAAGIKLFSDHKKMGAVGL
SPAILFNHIILGKKVLDYLTKEFKPDLVLLTDYGAFNLNMAKFLKKAGIKTFYYIPPQVW
ASRKWRINAIKKNIDEVLCIFPFEKEMYENHGIKTHYCGHPLVSQLPQKANREEFFAKYD
LDKNKKLVAIFPGSRKFELAQLMKVFVKTAKNLQKLHPDVQFVISHAPNLPDAVFDKYLK
HTDYKVIKGDNQALLSVSDALILASGTVALEAAIYETPMIIAYRGPWLFYLIYLIVRCIK
MVSLPNIIAGKIVVPEIIQGKVNIENISYEIEKILYDKDYRNNFVKELSQVKSKLSDKIS
SKEAAIEIEKALQNVK

Enzyme Prediction     

No EC number prediction in MGYG000001960_01052.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	355	1e-107	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	9.71e-112	1	355	1	359	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.65e-100	1	365	1	372	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.01e-77	4	330	1	334	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	6.16e-65	4	375	8	382	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	6.71e-46	1	355	1	332	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39331.1	4.92e-197	1	374	1	374
AEH45383.1	2.23e-75	3	355	10	359
AKQ33376.1	9.28e-74	2	365	6	369
VEH12442.1	6.70e-73	2	356	5	363
QTS83715.1	8.16e-73	2	355	6	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	3.19e-41	4	319	9	329	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	3.19e-41	4	319	9	329	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q39T49	1.45e-68	2	355	7	363	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q5ZVR9	2.05e-68	3	356	6	363	Lipid-A-disaccharide synthase 1 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=lpxB1 PE=3 SV=1
Q2LVL8	2.81e-68	2	366	4	372	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q5WWX7	4.48e-67	3	356	6	363	Lipid-A-disaccharide synthase 1 OS=Legionella pneumophila (strain Lens) OX=297245 GN=lpxB1 PE=3 SV=1
Q5X5J5	4.93e-66	3	356	6	363	Lipid-A-disaccharide synthase 1 OS=Legionella pneumophila (strain Paris) OX=297246 GN=lpxB1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001960_01052.