CAZyme Information: MGYG000001961_00658

Basic Information

• Species: Frisingicoccus sp900753685
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Frisingicoccus; Frisingicoccus sp900753685
• CAZyme ID: MGYG000001961_00658
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425	MGYG000001961_16|CGC1	49499.26	6.832

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001961	2208468	MAG	Denmark	Europe

• Gene Location: Start: 22908; End: 24185 Strand: +

Full Sequence      

MNINQSILKVSETLKPILKKIFPQKLLQKIKQFFVEKNYNQMIKRGRKPFDRHKFPDGIN
LLGLVRAEMGLGQSCRLLANELKAGDIPYSLYDFQLGSKLLQAEDHSMDEKICEEFPYNI
NLIHINPDEMMLMYTRMAAERWDNRYNIAFWLWELEEIPEHWQKFFPMLDEIWTPSEFIS
KNLRKVTELPVYTLPYCVEAPIDPALDREYFGLPEDKFLFLVMYDSNSTIERKNPTGAIR
AFRKAFKNNADVGIVVKVNNAKPRDMEHLNHMLADCQNVYFITNTLTKVEVNSLIGQADV
FVSLHRAEGFGLVMAEAMIAGTPVIATNWSSNTEFMNSNVACMVDCDFVSLKKDSPPYKK
GSVWAEPDIDMAARYMRKLYRDPEFYNKLKREARAYILEKLSMENAVGRLEKRVGEIYET
FERNI

Enzyme Prediction     

No EC number prediction in MGYG000001961_00658.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	231	388	2.3e-17	0.85625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	3.07e-24	174	412	146	363	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	5.29e-21	140	412	122	372	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd01635	Glycosyltransferase_GTB-type	2.25e-18	133	344	17	234	glycosyltransferase family 1 and related proteins with GTB topology. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam00534	Glycos_transf_1	3.90e-16	231	394	13	156	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03798	GT4_WlbH-like	1.36e-15	201	413	181	372	Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR71127.1	3.79e-125	1	418	1	427
AZS17521.1	1.00e-106	15	422	22	429
BBI36185.1	3.70e-104	15	410	17	416
AOZ93295.1	3.97e-104	15	417	24	428
ASS69318.1	6.21e-103	28	417	13	403

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001961_00658.