CAZyme Information: MGYG000001961_01637

Basic Information

• Species: Frisingicoccus sp900753685
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Frisingicoccus; Frisingicoccus sp900753685
• CAZyme ID: MGYG000001961_01637
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
733	MGYG000001961_72|CGC1	86592.75	7.1461

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001961	2208468	MAG	Denmark	Europe

• Gene Location: Start: 214; End: 2415 Strand: -

Full Sequence      

MYNVIECTNIPKDKLITIIRPIRVDADTEYLLSRVDNHINDKYISDTVGFIVVDDGSSRE
YCHNIKRICLESNIGYIHIDSELDKFSPSRARNIGSIYASSKYIFMQDIDLYPYDNFYNN
LIEQIIIQDLDSDITRFIMVPCIYLNTEGLQVLNDGSAINKNILLNDAILGNDRYIERIS
TGTSSCVFNREHFLRSGGYYEEFSGWGYEDLELNCRMIRKSKDFPTPRDWSLERFNFNTI
YEYSGWKAVYRLYGDICFYHGIVLFHGTHKIKQDLLREVQRKKNYQFFIDNLKNLKDPDP
LPDIYCGNTLVMKKCIFTMNPDIISWYGHVYIKDDYGLETLEEIIDFIEQKNINRIVFLN
PYSNQLNIDLYRYVRKYDIEYIICERGALPGTFFFDKNGFLADSSSYHESNWARELNNDE
KCNILKYIQNLFSSENTLEKQGSKKTVQEIRKKFNIGHKKVIFVPFQRPHDTAVEFFSRK
NTYDDFIDIIRELSKTISKDYILMVKRHPLEDEDFEIENVTYVNDIHINVLVEISDFIVT
FTSGVGLLGVAAGKPVFTIGSSFYSHEGFSWNVDSYQELIDLIYKNVRPDRERALAFLYY
LIYKFYSIGQFVTRDVTMEDGKRMTATIGIKNNIIRYKDKETIFYVDKKPRYSWSALLFD
RYRFSENIFAKNKNLVKEKNVKENITKELSSIKRVQKENISQKETTHQDVVMRKFRKLLR
SPIQFFKDSRWLK

Enzyme Prediction     

No EC number prediction in MGYG000001961_01637.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	17	294	1.1e-32	0.9963768115942029

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10111	Glyco_tranf_2_2	9.89e-25	17	294	1	276	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd16438	beta_Kdo_transferase_KpsS_like	3.92e-24	375	601	19	243	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsS like. KpsS is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria.
COG4092	COG4092	6.47e-18	14	299	2	297	Predicted glycosyltransferase involved in capsule biosynthesis [Cell wall/membrane/envelope biogenesis].
cd16441	beta_Kdo_transferase_KpsS	8.60e-10	463	606	147	307	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsS. KpsS is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria.
pfam05159	Capsule_synth	1.37e-09	459	611	145	309	Capsule polysaccharide biosynthesis protein. This family includes export proteins involved in capsule polysaccharide biosynthesis, such as KpsS and LipB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWB68404.1	2.14e-149	12	668	12	678
AIF80905.1	1.00e-146	5	732	7	725
AXE29592.1	6.29e-137	15	729	8	720
QEN02004.1	1.47e-128	13	663	19	675
CAQ71699.1	1.81e-124	13	663	5	661

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001961_01637.