CAZyme Information: MGYG000001962_00477

Basic Information

• Species: CAG-877 sp900554315
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-877; CAG-877 sp900554315
• CAZyme ID: MGYG000001962_00477
• CAZy Family: CBM50
• CAZyme Description: Cell division suppressor protein YneA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399	MGYG000001962_4|CGC1	44514.23	4.7125

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001962	1407635	MAG	Denmark	Europe

• Gene Location: Start: 73867; End: 75066 Strand: +

Full Sequence      

MNERKITGVVVDSGHGGSDPGAISGSLKEKDLTLKAANYMTRRLQELGIPVVSIKTTDED
ISRTERLRRANEAFNGDPNAILISNHINSGGGEGAEIIYGLRNDDTLASMALENIGDAGQ
KKRKIYQRRLPENPSKDYYYIIRETAPMQSLLVEYGFIDNAQDQQKLQNNLEDYVEGVVK
AIADYGGYNYLPPDISSSQDTYMVQKGDTLSKIANQFNTTVEELKKLNNLTSDLIQIGQI
LFIPVTSISPTETYTVKKGDTLYSISQRYGVTVEELKLTNNLTNNNLYIGQELKVPTKEI
NEDYEIYTVVKGDSLWLISQKYNVPVDDLIEINNLETVNLQIGDKLKIPKNSTETTYIVK
KGDSLWSIAKDNNISVEELKMANNLTSNLLSIGQKLIIP

Enzyme Prediction     

No EC number prediction in MGYG000001962_00477.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	254	296	2.6e-17	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK06347	PRK06347	5.53e-47	196	398	327	591	1,4-beta-N-acetylmuramoylhydrolase.
cd02696	MurNAc-LAA	2.76e-36	9	184	2	169	N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino acids in certain cell wall glycopeptides. These proteins are Zn-dependent peptidases with highly conserved residues involved in cation co-ordination. MurNAc-LAA in this family is one of several peptidoglycan hydrolases (PGHs) found in bacterial and bacteriophage or prophage genomes that are involved in the degradation of the peptidoglycan. In Escherichia coli, there are five MurNAc-LAAs present: AmiA, AmiB, AmiC and AmiD that are periplasmic, and AmpD that is cytoplasmic. Three of these (AmiA, AmiB and AmiC) belong to this family, the other two (AmiD and AmpD) do not. E. coli AmiA, AmiB and AmiC play an important role in cleaving the septum to release daughter cells after cell division. In general, bacterial MurNAc-LAAs are members of the bacterial autolytic system and carry a signal peptide in their N-termini that allows their transport across the cytoplasmic membrane. However, the bacteriophage MurNAc-LAAs are endolysins since these phage-encoded enzymes break down bacterial peptidoglycan at the terminal stage of the phage reproduction cycle. As opposed to autolysins, almost all endolysins have no signal peptides and their translocation through the cytoplasmic membrane is thought to proceed with the help of phage-encoded holin proteins. The amidase catalytic module is fused to another functional module (cell wall binding module or CWBM) either at the N- or C-terminus, which is responsible for high affinity binding of the protein to the cell wall.
PRK06347	PRK06347	4.07e-30	247	396	326	521	1,4-beta-N-acetylmuramoylhydrolase.
COG0860	AmiC	8.89e-29	9	185	45	227	N-acetylmuramoyl-L-alanine amidase [Cell wall/membrane/envelope biogenesis].
pfam01520	Amidase_3	1.56e-28	9	184	1	170	N-acetylmuramoyl-L-alanine amidase. This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVK20078.1	6.67e-71	9	296	2	284
QIC05530.1	6.85e-41	9	192	85	262
QOS97536.1	7.07e-39	9	198	157	340
AUM64330.1	1.79e-38	9	190	157	332
AGR47373.1	1.83e-38	9	192	158	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5J72_A	6.37e-14	9	167	454	616	ChainA, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630],5J72_B Chain B, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630]
4B8V_A	1.46e-13	196	356	38	224	ChainA, Extracellular Protein 6 [Fulvia fulva],4B9H_A Chain A, Extracellular Protein 6 [Fulvia fulva]
4UZ2_A	4.78e-09	253	299	4	50	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]
4XCM_A	5.43e-08	253	299	4	50	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]
1JWQ_A	4.14e-06	9	184	4	170	Structureof the catalytic domain of CwlV, N-acetylmuramoyl-L-alanine amidase from Bacillus(Paenibacillus) polymyxa var.colistinus [Paenibacillus polymyxa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O07532	8.10e-28	201	348	175	350	Peptidoglycan endopeptidase LytF OS=Bacillus subtilis (strain 168) OX=224308 GN=lytF PE=1 SV=2
Q49UX4	3.27e-23	201	348	28	193	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sle1 PE=3 SV=1
P54421	2.93e-21	196	356	22	200	Probable peptidoglycan endopeptidase LytE OS=Bacillus subtilis (strain 168) OX=224308 GN=lytE PE=1 SV=1
O31852	5.22e-21	193	348	81	268	D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlS PE=1 SV=1
Q5HRU2	1.46e-19	201	349	28	191	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000079	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001962_00477.