CAZyme Information: MGYG000001963_01385

Basic Information

• Species: Phocaeicola sp000434735
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp000434735
• CAZyme ID: MGYG000001963_01385
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368	MGYG000001963_26|CGC2	41435.24	7.9954

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001963	3288738	MAG	Denmark	Europe

• Gene Location: Start: 33688; End: 34794 Strand: +

Full Sequence      

MKNVIITCLLLLQFMQLSAQQYRSNMPWIDLSENHAIQTVISQGTPLVYNGHPTTLLLED
QKTILCVWSSGHGGKASYMGISNNAGLSWNVQETPADWQGMSNCPSIYQMTDKKGCQRLF
VFCGDPDMGYSYSEDNGKSWSKVKSLHKPCVMAFTSIVRLKNGDYMGFYHRGYKDRDQSP
LTLWSAVSHDGGLTWDESVKIASVEGRSPCEPCVFRSPNGKRLICIARENNRVGLSLMMY
SDDEGKTWSEMKETPWGLTGDRHVVRYTKDGRMVAVFRDMAPNSPTKGHFVAWVGNYKDL
VEDTSGQYRIKLLHSYAGSDCGYPGLEILPDGSLLAITYIKYNPGKEKHSIVQVKFKLDE
TDSMLKNR

Enzyme Prediction     

No EC number prediction in MGYG000001963_01385.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	9.00e-31	79	356	49	338	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	3.27e-13	91	334	70	278	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	2.09e-10	17	234	131	328	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	7.24e-08	40	199	101	255	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam15902	Sortilin-Vps10	4.91e-05	81	253	5	166	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDU73633.1	2.93e-109	26	366	204	546
QDV35524.1	2.42e-84	25	364	38	381
ALG49063.1	8.30e-56	8	366	179	568
AQW27075.1	2.25e-55	8	366	179	568
ATD48363.1	2.25e-55	8	366	179	568

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000195	0.999207	0.000152	0.000160	0.000137	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001963_01385.