CAZyme Information: MGYG000001963_01650

Basic Information

• Species: Phocaeicola sp000434735
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp000434735
• CAZyme ID: MGYG000001963_01650
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	MGYG000001963_35|CGC1	42447.36	7.5677

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001963	3288738	MAG	Denmark	Europe

• Gene Location: Start: 12496; End: 13593 Strand: +

Full Sequence      

MSKNLKLIIGALLLPTFLWAQKSPSTEALQDGIHHWNLLHPTRTYHRYAESEYEKIADNL
IGYQNEDGGWLKNMDWVGELNIDSVKATLNDHARRSTLDNRNTFPQIEYLADTYTLTHKE
KYREAAEKGLDYLLNTQKTNGGWRGWDVDAITFNDDVTTGALELLRNILQGDDSFLWLDK
SYMKRIKKAYKKGLDVVLKTQYVQNGVKTIWAQQYDNVTFEPVKARTFELPGVTAWESTE
IIMFLMGIQHPSKKVIEAVDCAIAWLEKNKIEGMKVEHVAIPKDKIINHEYPYDNVVVKD
PSAKPMWARYYELKDNTPFMAKRSGEKVWRLADVDPERRTGYDWYGYWPEKALKAYPEWK
KSIGK

Enzyme Prediction     

No EC number prediction in MGYG000001963_01650.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	64	351	5.9e-97	0.9930555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02474	pec_lyase	8.33e-92	64	353	1	290	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
pfam09492	Pec_lyase	3.92e-88	64	353	1	289	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
pfam13243	SQHop_cyclase_C	6.51e-04	112	201	79	172	Squalene-hopene cyclase C-terminal domain. Squalene-hopene cyclase, EC:5.4.99.17, catalyzes the cyclisation of squalene into hopene in bacteria. This reaction is part of a cationic cyclisation cascade, which is homologous to a key step in cholesterol biosynthesis. This family is the C-terminal half of the molecule.
cd02889	SQCY	7.01e-04	118	201	111	204	Squalene cyclase (SQCY) domain; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold. Squalene cyclase (SQCY) and 2,3-oxidosqualene cyclase (OSQCY) are integral membrane proteins that catalyze a cationic cyclization cascade converting linear triterpenes to fused ring compounds. Bacterial SQCY catalyzes the convertion of squalene to hopene or diplopterol. Eukaryotic OSQCY transforms the 2,3-epoxide of squalene to compounds such as, lanosterol (a metabolic precursor of cholesterol and steroid hormones) in mammals and fungi or, cycloartenol in plants. Deletion of a single glycine residue of Alicyclobacillus acidocaldarius SQCY alters its substrate specificity into that of eukaryotic OSQCY. Both enzymes have a second minor domain, which forms an alpha-alpha barrel that is inserted into the major domain. This group also contains SQCY-like archael sequences and some bacterial SQCY's which lack this minor domain.
cd02892	SQCY_1	0.001	118	201	394	489	Squalene cyclase (SQCY) domain subgroup 1; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold. Squalene cyclase (SQCY) and 2,3-oxidosqualene cyclase (OSQCY) are integral membrane proteins that catalyze a cationic cyclization cascade converting linear triterpenes to fused ring compounds. This group contains bacterial SQCY which catalyzes the convertion of squalene to hopene or diplopterol and eukaryotic OSQCY which transforms the 2,3-epoxide of squalene to compounds such as, lanosterol in mammals and fungi or, cycloartenol in plants. Deletion of a single glycine residue of Alicyclobacillus acidocaldarius SQCY alters its substrate specificity into that of eukaryotic OSQCY. Both enzymes have a second minor domain, which forms an alpha-alpha barrel that is inserted into the major domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37157.1	6.16e-153	1	359	1	360
QDU41600.1	2.28e-115	30	363	55	390
QDT46035.1	2.98e-113	30	363	55	390
QDU80650.1	2.18e-106	30	363	52	387
AOW11429.1	2.15e-93	25	362	31	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R76_A	3.43e-53	48	361	78	406	ChainA, pectate lyase [Niveispirillum irakense]
1GXM_A	6.41e-40	57	346	37	316	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	9.29e-39	57	346	37	316	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000389	0.998751	0.000348	0.000174	0.000161	0.000156

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001963_01650.