CAZyme Information: MGYG000001963_01765

Basic Information

• Species: Phocaeicola sp000434735
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp000434735
• CAZyme ID: MGYG000001963_01765
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377	MGYG000001963_39|CGC1	42997.99	8.9061

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001963	3288738	MAG	Denmark	Europe

• Gene Location: Start: 5104; End: 6237 Strand: -

Full Sequence      

MKYYLIVGEASGDLHASNLMKALMEEDPEAEFRFFGGDLMTAVGGTCVKHYRELAYMGFI
PVLLHLRTIFSNMDRCRHDIEAWKPDVLILVDYPGFNLKIAAYIKKHTQIPIYYYISPKI
WAWKEYRIKNIRRDVDKLFSILPFEVDFFRGHHYPVDYVGNPCVDAVDSFLRTDTETKEQ
FCQRLNLESSRPIIALLAGSRKQEIKDNLSRMMEASRSFPQFQFVIAGAPGIAPEFYSHY
LTDGAKIVFGETYRLLRHSEAALVTSGTATLETALFRVPQVVCYYTAAGKLVSFLRRHIL
KVKYISLVNLVSGSEVVTELVADVMTVDNIRRELSAIIEGGSRRIQMLSGYDRMIQILGT
PGASERAAKLMVKYLKK

Enzyme Prediction     

No EC number prediction in MGYG000001963_01765.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	358	7e-111	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	9.46e-110	1	377	2	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.27e-100	1	377	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	6.49e-76	4	368	2	368	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	6.98e-62	5	369	10	380	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.96e-47	1	371	2	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO23865.1	5.62e-202	1	377	1	376
ADY36062.1	2.03e-196	1	376	1	375
AII64873.1	9.13e-192	1	377	1	379
AND19645.1	9.13e-192	1	377	1	379
QJR71433.1	9.13e-192	1	377	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.77e-34	5	373	11	379	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.77e-34	5	373	11	379	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	1.08e-64	5	375	9	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	3.01e-64	5	377	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q39T49	1.33e-62	5	377	11	382	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B3E4H8	6.55e-59	5	377	11	382	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q6ALW0	1.96e-58	5	375	14	386	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001963_01765.