CAZyme Information: MGYG000001963_02195

Basic Information

• Species: Phocaeicola sp000434735
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp000434735
• CAZyme ID: MGYG000001963_02195
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
296		34057.95	10.1064

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001963	3288738	MAG	Denmark	Europe

• Gene Location: Start: 16000; End: 16890 Strand: -

Full Sequence      

MKHTLSIALALLLSILTSSAQSMRKNQAYEEYIHKYRGIAVEEMKLYHIPASITLAQGLL
ESGAGKGELARKSNNHFGIKCGSAWSGPNVRHDDDARQECFRAYRHAKDSYRDHSKFLRS
GARYAFLFQLSPTDYKGWARGLKKAGYATDPQYANRLINLIELYDLHRYDKKHGLKFAET
YPDPHQPYLANGLLYIVARPGDTFKNLGKELGISSRKLRKYNELPKDYTFRGGEIVYLEK
KNRRATKEHIVYVVRDGDSMYSISQKFGVRLERLYKMNDMHPDSPAPKVGDFIRLR

Enzyme Prediction     

No EC number prediction in MGYG000001963_02195.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	40	166	1.7e-35	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF038016	sporang_Gsm	1.35e-39	30	170	161	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
COG1705	FlgJ	6.27e-38	45	171	59	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	8.67e-29	23	170	2	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	2.76e-26	39	166	3	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
TIGR02541	flagell_FlgJ	6.80e-25	49	161	168	290	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO23242.1	8.22e-159	3	296	7	297
QEW37663.1	9.12e-149	1	296	1	297
QQY37845.1	9.45e-149	1	296	2	298
QQY41126.1	9.45e-149	1	296	2	298
ABR40001.1	1.13e-148	1	296	7	303

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	1.33e-14	49	161	21	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	1.61e-14	49	161	22	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	1.11e-13	49	161	22	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5DN5_A	6.49e-10	49	162	23	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	8.43e-10	49	162	23	146	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	5.12e-16	4	171	20	199	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	3.97e-14	16	160	147	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
P37710	1.47e-13	18	283	166	462	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q9KQ15	1.28e-10	16	160	140	302	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
Q9I4P4	5.28e-10	30	160	240	381	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000258	0.999050	0.000197	0.000149	0.000153	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001963_02195.