CAZyme Information: MGYG000001964_00215

Basic Information

• Species: Acetatifactor sp900772845
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor; Acetatifactor sp900772845
• CAZyme ID: MGYG000001964_00215
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329	MGYG000001964_2|CGC2	37885.43	4.4588

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001964	3194803	MAG	Denmark	Europe

• Gene Location: Start: 76761; End: 77750 Strand: +

Full Sequence      

MTTADPKATKEAKELLQYLHTVAGKQIITGQHTQTIPCEEIVYIRQTTGKEPKLRGFELL
AYSPNINYADASPECLKEVEENKGTVETALQWARANRPDKVNDTSTENSIDYTTGGILTF
SFHWFSPIGGRDKSFYTEHTDFDATKVLQEGTPERTAFYADMDVIADILRRFQDENIPIL
WRPFHESYGTWFWWGAKGAGVARDLYRLMFDYYTGEKDLHNLLWVWNSDIEEAYPGDEYV
DVVSMDVYLPEYQATDYADAYEKLVAATSRDKVAALAEVGCLPDIDLLQKNRIPWAYYMT
WSKEFCIGEKYNNVENLKKMYDSEYAVTL

Enzyme Prediction     

No EC number prediction in MGYG000001964_00215.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	5	329	1.8e-92	0.9867986798679867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	3.21e-51	5	328	2	308	Glycosyl hydrolase family 26.
COG4124	ManB2	4.58e-15	98	263	94	269	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM01251.1	2.50e-237	1	329	6	334
CBK82137.1	2.14e-157	4	328	5	311
AEB13973.1	6.06e-154	3	329	4	310
AZK45707.1	7.48e-129	1	329	4	314
AOZ93051.1	1.70e-123	2	329	8	317

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	3.30e-60	2	328	5	306	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	9.36e-60	5	329	147	444	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
3WDQ_A	5.02e-49	6	329	37	349	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	4.76e-44	8	301	50	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6Q75_A	1.14e-37	1	328	21	323	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	1.65e-58	5	329	176	473	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	7.12e-57	5	329	30	347	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P49425	9.93e-49	4	328	147	453	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
A2R6F5	9.22e-48	5	329	30	330	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55296	4.10e-40	2	329	156	457	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001964_00215.