CAZyme Information: MGYG000001964_00924

Basic Information

• Species: Acetatifactor sp900772845
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor; Acetatifactor sp900772845
• CAZyme ID: MGYG000001964_00924
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
678	MGYG000001964_12|CGC1	76973.32	4.7903

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001964	3194803	MAG	Denmark	Europe

• Gene Location: Start: 15486; End: 17522 Strand: -

Full Sequence      

MGIRAAVKQVLVAQQDKKYEKDLAQLKVTYEQWATEQERADAGNPSKAIGLETAEFVIFR
QVEGLLAENALQWINAYFARHPDVEIVYGDEDLLGDRGERCLPWYRPCWSPDTYRACFYV
GSVVAVRSRLLQRLGENPVVTESESTGKEVLFTNAEEIRPLMDRIFLAAGGFERDCHTIG
HIEKVLFHGNFPASGMGIQGPELCAGETKEVRNFWEAYLRTEESPQLAAKLADRTAEEIK
ELLTGERKVSVIIPSKDNPEVLEKCLISLTRRPESNVPIEILLVDNGSCAENKKKTEQLA
ERIRESGVTVRYIYEPEEFNFSAMCNRGAKLAEGNYLLFLNDDIEACGNDWLEKMVLHAM
QPYTGSVGLKLYYPDSVKIQHDGIVNLPVGPVHKLQFMEDDRSYYFGRNRYNQDCVAVTG
ACLLMKKEVFEEAGGFQEALRVAYNDVDLGFRLIEMGYYNVVLNDCFAYHHESLSRGSDE
SPEKMRRLTEERELLYQMHPQFRGEDPFYPQGLNREGLDSRVVPAYLTDRNILQEPVWKA
GLPGEEDLQKIRKDECLMARVETAGPERIQGYSVILGDDNACYEKYLLLLPAETDASQDT
DRGTWFMKLLPAYRQELEENLPDQKNVALGGFCVSRKGEQLPAGTYSIAVLAVNRVSKLK
LWNTTGKYMTVEKSRATE

Enzyme Prediction     

No EC number prediction in MGYG000001964_00924.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	250	432	5.6e-20	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	7.66e-33	251	472	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	9.79e-30	245	478	1	227	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	3.09e-21	250	430	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	1.27e-18	251	458	1	152	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd04184	GT2_RfbC_Mx_like	2.35e-18	5	188	44	199	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM02107.1	0.0	1	673	1	669
AOZ95571.1	1.91e-119	58	673	91	703
ADL33298.1	1.27e-116	58	663	91	694
QWT52131.1	3.96e-96	46	648	471	1034
CBK92935.1	2.55e-92	46	519	133	582

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q50864	3.27e-49	55	483	403	805	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P55465	1.56e-46	46	519	441	894	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
P9WMY2	3.30e-06	262	479	18	244	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	3.30e-06	262	479	18	244	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2
D4GYG7	4.32e-06	249	470	8	208	Glycosyltransferase AglE OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001964_00924.