CAZyme Information: MGYG000001964_01617

Basic Information

• Species: Acetatifactor sp900772845
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor; Acetatifactor sp900772845
• CAZyme ID: MGYG000001964_01617
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MGYG000001964_27|CGC1	41918.79	4.168

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001964	3194803	MAG	Denmark	Europe

• Gene Location: Start: 24826; End: 25947 Strand: +

Full Sequence      

MRLPDDYEDHGGGLTPTVISAIVAVTIFVAVILAVVLIMNRQPASHQQNNTAAQTENVQQ
AGNDQTNQYPDTQDLVTGSTLTPSDLDFWDLYPETTATPLPSEEPSKTDSKKETEETDPS
TDGKHTLVVNRDGKEEWVLISPYLPKHEYDFTKLVCQSDLMKYYQDGKQTSYVGVDISKY
QDYVDFLKLKKAGVDYVMLRVGARGYGSGQIALDDYFADNMKRAGDAGLQIGVYFSSQAI
TEEEAVEEANMVLENIKDYKITYPVAFDMSFVDNDTARIETVSRADKTRIAKAFLDTIAA
AGYKTILYGDKEWLIKEIDLSKLSAYDVWLSQMEDVPDYPYRFTMWQYADDVTIDGIAGY
ANMNISFIDYSEK

Enzyme Prediction     

No EC number prediction in MGYG000001964_01617.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	175	357	4.4e-37	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	4.52e-67	174	367	3	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	7.96e-26	174	365	2	185	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06413	GH25_muramidase_1	5.22e-19	174	364	5	187	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
pfam01183	Glyco_hydro_25	9.22e-17	175	357	1	180	Glycosyl hydrolases family 25.
cd06522	GH25_AtlA-like	1.01e-13	175	367	4	192	AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain. Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM01196.1	1.17e-224	1	373	1	373
QCT06482.1	1.03e-58	142	370	89	319
BBF45127.1	2.63e-58	146	370	54	280
ABX43465.1	6.43e-58	119	372	368	623
QEK18217.1	6.81e-58	144	367	73	298

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
15	37