CAZyme Information: MGYG000001964_02783

Basic Information

• Species: Acetatifactor sp900772845
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor; Acetatifactor sp900772845
• CAZyme ID: MGYG000001964_02783
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
710		82025.71	4.9499

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001964	3194803	MAG	Denmark	Europe

• Gene Location: Start: 2589; End: 4721 Strand: -

Full Sequence      

MRQDLSRNWEILQDVHDTCEQLGLPEHEEFMTLRGPQISEWEPLPELKQLQLLYSEHPYW
GRELRYFNDAPWWYKKEFELSLDATDRVELCFTNVDYYCKIWLNGVYLGSHEGYSAPFSF
PLNEVVQRNGKNRLIVKVWSPWDEKVAGDRQEERTGAVYRNMVKGTYEHSDTFIQRDVNP
VGIYGSVSLRIQKGTGFAENPEFSYQLDEALERADLHLQVKVRRPEAVSLRWSITDCFTG
VVVLSKNEELTGVQPCGDSELAVACLDGTLSNVRLWNTWDKGTPFVYRVKVTLCAKNGTV
LDAYEETTGFRKIEMQRTPEMTKFILNGKDFYMRGTAYFPDVYVSAMNEERYRRDLLQIK
NSGFNMVRVHVHVDLPVFYELCDELGLGIMHDSEYNWTHPEDEAFADRFVHIYLETVDML
KKHPSLFCWICMNEPGDLTVSTGAKLFAAVCEHDPSRPVIKGSFCVDDPDSGDSHNYTGS
LDGGHYSDIYGTTEKMNTEFGFDAPPCIDDLKKMPPVYRRLQPILDNLDSIGQYQYHLLK
YYIEHYRMQKYKPNAGYVQFLFNDMCPQTFYGIYDYWGLPKKGLQAVLESNMPVGIFLKF
KDKLDAIYAVNDYSCALGICRVGYSITDETGKVVAEDAKDINIKEDSLTKLWEFDGTIHS
GSVYNVALWIEQDGKLLAQNGYHDVFYMPQHTPGHPTYMSHETGCRIYWA

Enzyme Prediction     

No EC number prediction in MGYG000001964_02783.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	647	2.2e-78	0.6808510638297872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.69e-36	71	459	64	429	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	6.26e-19	74	436	113	451	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	1.56e-17	73	459	68	445	beta-D-glucuronidase; Provisional
PRK09525	lacZ	3.06e-16	74	459	124	485	beta-galactosidase.
pfam02836	Glyco_hydro_2_C	2.95e-12	323	459	7	158	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE94705.1	2.00e-267	4	710	6	722
QIB56389.1	4.01e-262	4	710	6	722
QMW80836.1	4.01e-262	4	710	6	722
QJU16953.1	3.74e-260	3	710	5	722
QCU02238.1	5.66e-257	2	710	4	722

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	1.54e-29	63	689	73	748	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
7SF2_A	1.01e-23	74	434	90	432	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6ED1_A	3.82e-21	73	457	80	447	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]
3GM8_A	8.06e-21	73	491	69	447	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
3DYO_A	2.92e-17	87	459	138	484	ChainA, Beta-galactosidase [Escherichia coli K-12],3DYO_B Chain B, Beta-galactosidase [Escherichia coli K-12],3DYO_C Chain C, Beta-galactosidase [Escherichia coli K-12],3DYO_D Chain D, Beta-galactosidase [Escherichia coli K-12],3DYP_A Chain A, Beta-galactosidase [Escherichia coli K-12],3DYP_B Chain B, Beta-galactosidase [Escherichia coli K-12],3DYP_C Chain C, Beta-galactosidase [Escherichia coli K-12],3DYP_D Chain D, Beta-galactosidase [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P81650	1.13e-21	74	459	124	483	Beta-galactosidase OS=Pseudoalteromonas haloplanktis OX=228 GN=lacZ PE=1 SV=2
B4S2K9	1.04e-20	81	459	132	483	Beta-galactosidase OS=Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype) OX=1774373 GN=lacZ PE=3 SV=1
A5F5U6	3.10e-20	39	459	77	482	Beta-galactosidase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=lacZ PE=3 SV=2
Q7MG04	1.24e-19	39	459	77	480	Beta-galactosidase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=lacZ PE=3 SV=1
Q6LL68	3.74e-19	79	459	128	479	Beta-galactosidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001964_02783.