CAZyme Information: MGYG000001965_00385

Basic Information

• Species: CAG-510 sp900550475
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-510; CAG-510 sp900550475
• CAZyme ID: MGYG000001965_00385
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
681	MGYG000001965_2|CGC4	78387.56	6.8016

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001965	2761020	MAG	Denmark	Europe

• Gene Location: Start: 150908; End: 152953 Strand: -

Full Sequence      

MTEIDYREAYEKEKERCADLADKIVVLEAEKEDLQFKLDRIKKNKLWKATGPARSVFHFV
QRQKDRLSHCGGPRDVLRKIRNKKRQKGQMVSYGTGSFPDEARRREEQETVFPRMVKISI
LVPLWNNKREFQIQMLDSVMNQTYRNWELCLADGSDAEHAYIEEICREYAERSGGRIVYR
HLDHNGGIAYNTNECYKLATGEYIGLFDQDDILHPSVLFEYVKAINRQNADYLYCDETTF
KDNDINKMLTMHFKPDYAPDNLRANNYICHFSVFSRTLLEGEELFRPAFDGSQDHDMILR
LTDRAQHIVHIPRLMYYWRSHEGSTAAGIEAKPYAIEAAKGAIAEHLKKHGFSHFQITST
RACATIFRIRYRICGNPKISIVIPNKDHLSDLKRCVSSIQKNSTWENYEILIVENNSTTP
EIKDYYTMLLGCSYEENRQREADGRDGGVLRSRNGKVSVVTYCGMFNYSAVNNLGVSYAA
GDYVLLLNNDTEVITANWMEELLMYAQREDVGAVGAKLYYANKTIQHAGVVIGLGAHRTA
GHTHYGVPVQNLGYMGRLCYAQDVSAVTGACLLVKKSLYEELGGLDESFEISLNDVDFCL
RLRERGLLNVWTPFAELYHYESVSRGLDDQGEKAERYNRESAHFREKWKQALSIGDPYYN
PNFSLDRSDYALKDPVEYGKI

Enzyme Prediction     

No EC number prediction in MGYG000001965_00385.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	119	276	1.4e-20	0.9529411764705882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	3.12e-74	117	319	2	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	2.20e-37	381	621	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	5.58e-26	375	647	1	249	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	1.01e-17	119	325	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	1.50e-17	120	271	1	155	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM02106.1	0.0	1	680	1	685
ADL33299.1	1.49e-315	1	672	1	671
AOZ95572.1	3.84e-309	1	672	1	673
QUO22278.1	4.63e-270	37	673	17	629
CAB1243278.1	2.30e-218	6	674	385	1034

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	2.78e-12	118	318	7	215	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	5.30e-122	118	675	368	900	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.71e-80	100	680	301	848	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P77414	5.49e-11	118	311	7	207	Putative colanic acid biosynthesis glycosyl transferase WcaA OS=Escherichia coli (strain K12) OX=83333 GN=wcaA PE=4 SV=1
A0A0H2UR96	7.23e-10	118	246	5	129	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
Q58457	9.04e-09	118	300	10	193	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001965_00385.