CAZyme Information: MGYG000001965_00629

Basic Information

• Species: CAG-510 sp900550475
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-510; CAG-510 sp900550475
• CAZyme ID: MGYG000001965_00629
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
295	MGYG000001965_4|CGC2	33918.36	5.1286

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001965	2761020	MAG	Denmark	Europe

• Gene Location: Start: 51739; End: 52626 Strand: +

Full Sequence      

MNRTAQNLYLFLNSLKGIGILSGQQECPRDQTNGDELSHIFECSGHLPAILGLDYIENDF
EGVNARAKSWHDRGGIVSICWHWGIPPYGVGYPSSQESVDMKELLTPGTALYQGLLDNLD
AAAAALSVLRDADIPVLWRPLHEFDGAWFWWGKGGPEPFIALWRLMYDRFTNLHHLDNLI
WVLGYSHEMHDGWYPGDAYVDCIGGDAYTEGIHEELYRFLKKITDKQMPVCHHENGPIPD
PQLLIDRHVEWCWFLTWHTIHIHEQNSPEYLHYVYNHPYVITLEDLPAFMKPKAP

Enzyme Prediction     

No EC number prediction in MGYG000001965_00629.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	2	284	2.3e-83	0.976897689768977

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	5.59e-45	3	282	7	308	Glycosyl hydrolase family 26.
COG4124	ManB2	1.27e-14	134	208	180	256	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCN30282.1	2.69e-132	3	289	13	299
ADU20874.1	4.13e-89	5	287	176	460
AOW25662.1	1.08e-86	5	286	10	294
AJP70762.1	5.43e-86	5	286	31	318
ATC26721.1	3.81e-82	5	286	10	294

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	1.46e-51	5	286	15	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	1.56e-50	5	286	154	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6Q75_A	8.38e-49	11	286	38	327	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
3WDQ_A	9.12e-46	5	289	43	355	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	1.18e-40	5	289	54	359	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	2.04e-54	4	286	182	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P49425	1.66e-53	4	287	154	458	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
Q5AWB7	3.56e-45	2	286	34	350	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
A2R6F5	1.22e-44	5	283	37	330	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55296	1.36e-37	5	289	166	463	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999672	0.000365	0.000002	0.000001	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001965_00629.