CAZyme Information: MGYG000001965_00921

Basic Information

• Species: CAG-510 sp900550475
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-510; CAG-510 sp900550475
• CAZyme ID: MGYG000001965_00921
• CAZy Family: GH53
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1043		111353.15	4.1529

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001965	2761020	MAG	Denmark	Europe

• Gene Location: Start: 106888; End: 110019 Strand: +

Full Sequence      

MKRSGLRRATGILLAAVLVLCQFMGDGNKITAHAKQTNVFSEDFENVTYAGNVLNDHLTV
ETENVTWEVKSDQWAANNKTNFLNLSNDTSEALSFSVTATVAAEAGTYQASWKSEGDASE
SGLSGQLATEDKAVASDAVAITTTGWDVWSTLTTEEIELTEAGTLVLTISGTVPAGYWGK
LDDITISKITEDGEDGGSGGDGDDGETVTPVEAGILIDRVTGMGDDFIKGVDVSSYLAEV
DSGVTFKDFSGNTLSRAGFFGLLKESGVNYVRIRVWNNPYDGNGNGYGGGNNDLTKAVTM
GKLATEAGMRVLIDFHYSDFWADPAKQSAPKAWSDYSVEEKETAIADFTRSSLQTLLDAG
VDVGMVQVGNETTGGLCGETDWSNICKLMNAGSSAVRTVAASYGREIKVALHFTNPEKSG
RYASIASTLFTNSVDYDVFASSYYPVWHGTLGNLTSVLKNIADTYGKEVMVAETSYAYTY
EDGDGHENTVLEGKAGLSMQYSVSVQGQAKEVRDVMQAVANVGDAGIGVFYWEPAWIPVA
VYDAQADNAAEVLASNKEKWEQYGSGWASVHAGEYESDAAQWYGGSAVDNQALFDFYGNP
LESLKVFRYVDTGTTCEKKVESVESPVSVTVLENEAETVSLPGTVTVTYNDGSEGVAAVN
WDAEALAAAIRSGAGSYTINGTANVDGENCAVICILKIEPANLLVNPGFEEGAAFGWTVT
GEGATIKQAGNDCRSGNWALHFWYGSDFSYKAVQTVTLEPGTYVLSAYLQGGDAGEGDSF
CLFVDCGVTEDGTHTFTAGTAPNGWCNWQNPTISDIVITETTTVTVGVAVSASSGAWGTW
DDFYLYRVTEKETEDGGITAEVTPVTASPVSKSSVNWSEVQKKLRELPEETVNVVVGNRR
AAVPLEACRLLAEKNGTLALHTGTGIAISLEGKNIKEEPKALQIRVTETVKLSGEAVKKL
SEETIAYRAFRVEADTLSGEESRFGMGIHLALGAENAGKTAKLYRMEETTGEWILSGIFN
ITDSGQAMFAWCGNADYIAVVEK

Enzyme Prediction     

EC	3.2.1.89

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	228	607	5.4e-126	0.9970760233918129
CBM61	702	845	6.7e-32	0.9858156028368794

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3867	GanB	2.10e-146	208	619	20	403	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].
pfam07745	Glyco_hydro_53	9.36e-131	228	607	1	333	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
pfam07532	Big_4	5.88e-07	625	683	2	56	Bacterial Ig-like domain (group 4). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in a variety of bacterial surface proteins.
cd04080	CBM6_cellulase-like	0.007	87	178	53	136	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK73963.1	1.38e-268	1	864	4	855
QNM03783.1	4.66e-244	66	1041	243	1297
AYA74678.1	1.41e-225	105	848	107	811
SQI62631.1	1.68e-225	90	854	90	815
BAB05742.1	1.03e-218	99	915	107	883

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R8L_A	1.52e-169	212	614	9	395	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]
2GFT_A	1.19e-168	212	614	9	395	ChainA, Glycosyl Hydrolase Family 53 [Bacillus licheniformis],2GFT_B Chain B, Glycosyl Hydrolase Family 53 [Bacillus licheniformis]
7OSK_A	4.81e-74	215	619	38	403	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
4BF7_A	2.17e-39	229	537	22	318	Emericillanidulans endo-beta-1,4-galactanase [Aspergillus nidulans]
1HJQ_A	2.49e-39	229	537	5	301	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q65CX5	2.01e-168	212	614	34	420	Endo-beta-1,4-galactanase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ganB PE=1 SV=1
O07013	4.14e-166	215	619	41	429	Endo-beta-1,4-galactanase OS=Bacillus subtilis (strain 168) OX=224308 GN=ganB PE=1 SV=1
P48843	3.77e-55	227	538	6	314	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
P48841	1.66e-42	221	537	19	330	Arabinogalactan endo-beta-1,4-galactanase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ganB PE=1 SV=1
Q0CTQ7	1.15e-40	229	536	19	316	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=galA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004117	0.492945	0.501564	0.000841	0.000291	0.000213

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001965_00921.