CAZyme Information: MGYG000001965_01413

Basic Information

• Species: CAG-510 sp900550475
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-510; CAG-510 sp900550475
• CAZyme ID: MGYG000001965_01413
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358	MGYG000001965_12|CGC1	39360.16	5.3434

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001965	2761020	MAG	Denmark	Europe

• Gene Location: Start: 43943; End: 45019 Strand: -

Full Sequence      

MIHLYVNYPEQTPCYRSVSEALSSLPEIELLPQAFPAPGEPQAEPVTVHIAPGIYEELLV
VERPYVTFLGEDALKTVLSFHLGAFEAMPDGSRRGTFRTASVRVHAHNFTARNITFQNTA
GYGHTVGQALALYADGDRLVLENCRLISSQDTLFTAPLPPTAAKPGGFTGPGEHAPRINN
RQYYVNCFIQGDVDFIFGGAIAYFQGCTIFSKKPGDRKPPESPADEVIYGYATAASTPKD
LPFGYVFENCCFDSDCPPRSVYLGRPWREWAKTVLLRCSLGSHIHPAGWNDWGKPHDHFY
YGEYLCTGEGAAASERAAFSHLLSDNEAALYTVQNVLGEPDGWNPQVTCSPQSPCADR

Enzyme Prediction     

No EC number prediction in MGYG000001965_01413.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	12	337	1.5e-82	0.9618055555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	2.43e-65	15	338	12	296	Pectinesterase.
COG4677	PemB	1.74e-61	37	337	104	402	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02708	PLN02708	3.36e-54	14	347	252	552	Probable pectinesterase/pectinesterase inhibitor
PLN02432	PLN02432	1.10e-47	15	338	23	287	putative pectinesterase
PLN02682	PLN02682	2.06e-46	15	328	82	352	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM04098.1	1.84e-149	15	346	11	340
ABX41678.1	1.89e-120	15	347	17	341
SET76962.1	2.40e-115	1	345	1	321
ADZ82949.1	1.48e-101	47	345	30	320
QEH68466.1	5.94e-101	47	345	30	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	2.33e-37	15	332	19	297	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	4.77e-30	27	337	14	298	ChainA, Pectinesterase 1 [Solanum lycopersicum]
3UW0_A	1.39e-27	45	315	60	339	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	4.71e-26	45	345	34	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1E_A	2.37e-21	48	316	38	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LXD9	1.26e-39	15	343	251	546	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1
Q9FM79	3.04e-39	46	327	110	362	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q8L7Q7	1.07e-38	15	343	301	597	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2
P83218	1.28e-36	15	332	19	297	Pectinesterase OS=Daucus carota OX=4039 PE=1 SV=1
Q8GXA1	2.42e-36	15	346	268	559	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001965_01413.