CAZyme Information: MGYG000001967_00574

Basic Information

• Species: CAG-492 sp900557045
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-492; CAG-492 sp900557045
• CAZyme ID: MGYG000001967_00574
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410		47720.85	7.3185

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001967	1715002	MAG	Denmark	Europe

• Gene Location: Start: 16084; End: 17316 Strand: -

Full Sequence      

MEYLYILQQAMVWIITIYWIYQLVISLCSLIKVKEKPLVEEKEHRFMAIIPAHNEEKVIS
NLVESLKNQNYSKNLYDIYVIADNCTDETAQKAKEAGAIVYERFDEEHKTKGYALNWFLQ
QKIEEDAPYDAFCIFDADNIVDVNFLKAMNKKLCQGEDVVQGYRDIKNPSDSWVSAGYAI
FYWTMNRFYHLARYNLGLSPLINGTGFMVKFDVVKPEGWNTKTLTEDIEFSLKRIIAGKK
LGWATDAIVYDEQPVGFKQSWSQRSRWTVGHIQCLKEYTKPLAVAVKDNKTVMNFDGLLY
MLGSIPMFVLTLVLLILNFVIYLTNGMSTTELLWNAVRYLVPTFLLPIFTGIMIMLIDKK
PIKPMIKGLLLYPLFLGSWLLINFKCLFKRDTKWEKIEHNIDKSIEDMNK

Enzyme Prediction     

No EC number prediction in MGYG000001967_00574.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	45	270	3.7e-24	0.991304347826087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	1.78e-87	49	230	2	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
cd06423	CESA_like	3.22e-50	49	227	2	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	1.83e-45	1	389	6	399	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06421	CESA_CelA_like	1.30e-20	45	273	2	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
pfam13641	Glyco_tranf_2_3	2.77e-20	45	267	3	227	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWT55360.1	1.13e-115	20	408	23	413
BCI60981.1	1.29e-107	6	408	10	413
CDZ24461.1	7.10e-107	16	408	19	409
BBB93061.1	3.23e-98	14	408	15	407
AUG58434.1	1.88e-96	45	410	51	417

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	7.66e-14	49	398	54	412	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q8YMK0	3.60e-09	49	278	111	341	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
Q3MB01	1.49e-08	49	278	111	341	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
Q47536	3.87e-07	34	282	22	266	Uncharacterized glycosyltransferase YaiP OS=Escherichia coli (strain K12) OX=83333 GN=yaiP PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	27
191	209
299	321
334	356
366	388