CAZyme Information: MGYG000001967_00993

Basic Information

• Species: CAG-492 sp900557045
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-492; CAG-492 sp900557045
• CAZyme ID: MGYG000001967_00993
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
885	MGYG000001967_35|CGC1	97134.1	8.5996

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001967	1715002	MAG	Denmark	Europe

• Gene Location: Start: 5189; End: 7846 Strand: -

Full Sequence      

MSGRTNNSKKGKNTNNGPIRSAAKNKKNKNMKRDHSKMKKIIIIIVILILLLILIAGGVF
VGIFFSDKFAMTKEDLLIGYSNTIIYDAEGNVISELSGKENRKIISINDMSEYLPKAFVS
IEDERFYKHNGVDIKRTAAATLTYVTHSGSSNFGGSTITQQLVKNITNEKESSGKAGMQR
KIREMSRAYQIEKMISKEQILELYLNLIPLASSGGDICGVETASLYYFNKSASELSIEEC
AFIAGVTHSPNQYNPYKENPNTEKIKSRTKTVLGKMKELGYINNEQYNEAIGKVDEGLKF
QKGELSTSTIKSYYISSAVDQVVNELVEEKGMSKEYAKSRVYGGGLKIYTTQIASIQKTV
EEEYKNDKYVKPGKTKANEGGHTQSAMVIIDHKTGRVVGCMGGLGNDVDAVGINRIYSVR
QPGSSIKPIGVYGPALEKEIINASTVYDNSYTVFGKDYDPSNATSAKSGLCSIRDAIEVS
SNIVACKVMTELGPDNAIDFMRQLGITSLVKSSELTDPSKLNDSNISTALGTCTISPLQM
AAAYATIANNGVYIEPTFYTKVEDSSGNILIENKQDTRRVMSEGNAYVMKSLLKQPVEGS
NGTAKICKMGNIDVGAKTGTTQEQNDVWLCGFTPYYTAATWFGYDYKEYVNTYGGSPATL
IWASVMKNIHSGLESKLFEKPSNVVTATVCRSSGKCATSSCTSTYTEYFVEGAVPGKCEG
HNEFKICSESKKLATEYCTHTEIVKGLAMPEKEANAKWKTNRGDKYTVIAEKCTIHTETT
KREEENKKNEENKTNNKDTDITVENVVGKTESEARKILGNLTLKIEYKSDSTKTNGIVLS
QSIKPGSIVSKDAKITLIVNKIENKTPDENTNTNTNAGENVNKAQ

Enzyme Prediction     

No EC number prediction in MGYG000001967_00993.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	90	277	4.3e-58	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	4.53e-163	56	681	26	608	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	2.12e-159	101	672	1	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	3.29e-118	85	715	51	764	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG4953	PbpC	1.21e-74	107	715	63	602	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
TIGR02071	PBP_1b	1.01e-73	100	689	145	700	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEV70266.1	1.95e-139	57	766	41	754
AUG56612.1	1.11e-130	55	738	47	721
CBF97356.1	1.78e-130	71	743	64	737
CBF93836.1	1.78e-130	71	743	64	737
ABN52981.1	1.78e-130	71	743	64	737

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7U4H_A	1.53e-81	72	736	11	830	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3DWK_A	6.33e-57	85	684	10	602	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
3ZG8_B	5.10e-56	190	674	2	462	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
2OLU_A	5.16e-53	85	684	19	611	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
3UDF_A	3.90e-52	85	666	23	712	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A5I6G4	3.71e-113	55	737	26	718	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
A7FY32	3.71e-113	55	737	26	718	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
A7GHV1	2.56e-112	55	737	26	718	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
Q891X1	1.14e-110	83	721	61	713	Penicillin-binding protein 1A OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=pbpA PE=3 SV=1
Q0TNZ8	1.55e-109	83	726	72	729	Penicillin-binding protein 1A OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999716	0.000297	0.000001	0.000000	0.000000	0.000005

TMHMM  Annotations     

start	end
41	63