CAZyme Information: MGYG000001967_01696

Basic Information

• Species: CAG-492 sp900557045
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-492; CAG-492 sp900557045
• CAZyme ID: MGYG000001967_01696
• CAZy Family: GT2
• CAZyme Description: Cellulose synthase catalytic subunit [UDP-forming]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
547		62527.53	9.9305

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001967	1715002	MAG	Denmark	Europe

• Gene Location: Start: 10; End: 1653 Strand: -

Full Sequence      

MKQKNLFKFIFYTLTILLTFTYIIYRIFFTIPTTLGIIALISSILVLFIEIWESLDFFAY
YLNILCVKKTSPKIPDLSNITQYPDIDVLIATINEHESLLKNTITACKNMSYPDKSKIHI
YICDDGNRANIKKLAENLGVNYLSRITNKNAKAGNYNHALNHITSPFVATFDADMAPTPN
FLLTTLPFFFTGTDEIGFVQLPQSFNNPDIFQLRFKLENKIPFEQDYFYHSIQIAKNATN
SAIYCGTNALFSRKALNSCNGFAIGTISEDIATGMMIESKGYKCLALNNVEAYGTAVNDL
SGFVKQRSRWARGCVQILKKYNILKNKGLSFKQKIEYLSCISYWFFGVRRMVYLLTPLLF
SIFGVIIVDCNLTTFISIWLPTYILKRFTLDIFEGNKRSSTWNKIYETILTPVLCKEVLK
EFFGFGNTKFEVTPKSSQNLKMSKTNKQLLISHLVLLILNILGLIMCLFRIKTSGITVYI
LSLLWIISNIFYLTISVIFDSSVKCTASANFIPNKISVYKKLSVLGIFFNRNKLSKNTNT
IKKKQNK

Enzyme Prediction     

No EC number prediction in MGYG000001967_01696.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	87	257	4.6e-27	0.9764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03030	CelA	2.47e-95	14	435	63	498	cellulose synthase catalytic subunit (UDP-forming). Cellulose synthase catalyzes the beta-1,4 polymerization of glucose residues in the formation of cellulose. In bacteria, the substrate is UDP-glucose. The synthase consists of two subunits (or domains in the frequent cases where it is encoded as a single polypeptide), the catalytic domain modelled here and the regulatory domain (pfam03170). The regulatory domain binds the allosteric activator cyclic di-GMP. The protein is membrane-associated and probably assembles into multimers such that the individual cellulose strands can self-assemble into multi-strand fibrils.
cd06421	CESA_CelA_like	2.98e-91	84	318	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
PRK11498	bcsA	8.50e-69	79	435	255	609	cellulose synthase catalytic subunit; Provisional
COG1215	BcsA	3.73e-44	31	435	2	378	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06437	CESA_CaSu_A2	4.02e-24	84	313	1	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLY80065.1	5.47e-147	15	499	15	496
AAK79528.1	1.13e-143	15	499	17	496
AWV81228.1	1.13e-143	15	499	17	496
ADZ20613.1	1.13e-143	15	499	17	496
AEI33806.1	1.13e-143	15	499	17	496

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	1.99e-62	38	493	228	682	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	2.61e-54	53	435	96	496	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	5.59e-54	53	435	108	508	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	5.64e-54	53	435	109	509	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37653	9.52e-62	38	493	228	682	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3
Q8X5L7	1.31e-61	38	493	228	682	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2
Q93IN2	1.33e-61	38	490	228	679	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1
Q8Z291	1.83e-61	38	490	228	679	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1
P58931	6.44e-60	82	464	157	536	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29
33	55
358	380
449	471
476	498