CAZyme Information: MGYG000001970_00937

Basic Information

• Species: UBA2882 sp002362385
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA2882; UBA2882 sp002362385
• CAZyme ID: MGYG000001970_00937
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370		40094.95	8.3441

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001970	3441652	MAG	Denmark	Europe

• Gene Location: Start: 63873; End: 64985 Strand: -

Full Sequence      

MEIVESILKQNPCYKTGKKIRVTGLMLHSVGCPQPSAEVFVKNWNNAAAGRACVHAFIDA
GTGKIYQTLPWDHRGWHCGGKGNNTHIGVEMCEPDCIRYTGGASFQCTDEERARDMAKRT
YDRAVDLFAVLCKNYGLNPLADGVIISHKEGHARGIASGHGDPEHLWTGLKTGYTMDGFR
KAVSEAMEQLSLSREPMMPPPPMPGQPAAPPPPMPGTEPVPVYASSGEMSISDRGVELIA
KYEGCRLSAYKCPAGVWTIGYGHTAGVKPGDTLQNEQAAKALLKEDLKKYGGYVNDCVKK
GMISFPLTQNQFDALTSFTYNCGAGNLKKLVSGRDAATVAEKLLLYNKGGGKVLAGLVRR
REEERALFLG

Enzyme Prediction     

No EC number prediction in MGYG000001970_00937.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	231	364	1e-40	0.9927007299270073

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00737	lyz_endolysin_autolysin	1.91e-61	235	369	1	136	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
cd16901	lyz_P1	6.00e-48	230	367	1	138	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG3772	RrrD	2.67e-44	225	370	1	149	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
cd16900	endolysin_R21-like	3.57e-35	238	369	11	142	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
cd06583	PGRP	3.90e-23	21	163	1	123	Peptidoglycan recognition proteins (PGRPs) are pattern recognition receptors that bind, and in certain cases, hydrolyze peptidoglycans (PGNs) of bacterial cell walls. PGRPs have been divided into three classes: short PGRPs (PGRP-S), that are small (20 kDa) extracellular proteins; intermediate PGRPs (PGRP-I) that are 40-45 kDa and are predicted to be transmembrane proteins; and long PGRPs (PGRP-L), up to 90 kDa, which may be either intracellular or transmembrane. Several structures of PGRPs are known in insects and mammals, some bound with substrates like Muramyl Tripeptide (MTP) or Tracheal Cytotoxin (TCT). The substrate binding site is conserved in PGRP-LCx, PGRP-LE, and PGRP-Ialpha proteins. This family includes Zn-dependent N-Acetylmuramoyl-L-alanine Amidase, EC:3.5.1.28. This enzyme cleaves the amide bond between N-acetylmuramoyl and L-amino acids, preferentially D-lactyl-L-Ala, in bacterial cell walls. The structure for the bacteriophage T7 lysozyme shows that two of the conserved histidines and a cysteine are zinc binding residues. Site-directed mutagenesis of T7 lysozyme indicates that two conserved residues, a Tyr and a Lys, are important for amidase activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ98955.1	6.35e-95	1	188	1	192
QJU15163.1	6.52e-94	1	189	1	193
ADL53623.1	1.92e-93	1	187	1	187
AFC63685.1	1.04e-92	1	188	1	192
AMP42248.1	3.79e-90	1	187	1	191

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ET6_A	3.41e-33	227	369	48	194	ChainA, Lysozyme [Acinetobacter baumannii]
6H9D_A	2.03e-19	231	369	6	147	ChainA, Lysozyme [Asticcacaulis excentricus],6H9D_B Chain B, Lysozyme [Asticcacaulis excentricus],6H9D_C Chain C, Lysozyme [Asticcacaulis excentricus]
2ANV_A	1.46e-15	229	369	2	145	ChainA, Lysozyme [Lederbergvirus P22],2ANV_B Chain B, Lysozyme [Lederbergvirus P22],2ANX_A Chain A, Lysozyme [Lederbergvirus P22],2ANX_B Chain B, Lysozyme [Lederbergvirus P22]
1XJT_A	1.36e-14	220	369	19	179	ChainA, Lysozyme [Punavirus P1]
1XJU_A	1.43e-14	235	369	6	151	ChainA, Lysozyme [Punavirus P1],1XJU_B Chain B, Lysozyme [Punavirus P1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9T1T5	1.58e-25	229	368	1	143	Endolysin OS=Acyrthosiphon pisum secondary endosymbiont phage 1 OX=2682836 GN=13 PE=3 SV=1
Q37896	1.77e-22	229	369	1	143	Endolysin OS=Bacillus phage B103 OX=10778 GN=15 PE=3 SV=1
P07540	3.72e-20	229	368	1	142	Endolysin OS=Bacillus phage PZA OX=10757 GN=15 PE=3 SV=1
P11187	5.12e-20	229	368	1	142	Endolysin OS=Bacillus phage phi29 OX=10756 GN=15 PE=1 SV=1
P51728	7.48e-19	231	370	35	185	SAR-endolysin OS=Haemophilus phage HP1 (strain HP1c1) OX=1289570 GN=lys PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001970_00937.