CAZyme Information: MGYG000001970_02940

Basic Information

• Species: UBA2882 sp002362385
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA2882; UBA2882 sp002362385
• CAZyme ID: MGYG000001970_02940
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313	MGYG000001970_53|CGC1	36238.87	4.4836

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001970	3441652	MAG	Denmark	Europe

• Gene Location: Start: 10496; End: 11437 Strand: -

Full Sequence      

MKPVNPNATKEAEKLLNYLYETAGKGIITGQHTQTNPMEEIAYIKEKTGFLPKLQGFELL
AYSPNINYKDASEECLTEVEENKGTVETAIRWAKETKGIVTICFHWFSPIGGRDKAFYAR
NTDFDATKVLKEGTPEREAFYADMDVIAGELQRFKEESIPVLFRPFHEAEGDWFWWGVKG
DAVGRELYKLMFEYYVNQKHLDNLLWVWNSPEAEGYPGDEYVDVISRDIYLTEKKATDYK
EEYEEMIAGTTDKKVAALAEVGYIPDVDMLKESRVPWAYYMSWSKEFCIGEQYNTVAETK
KMYESDYAIKLEQ

Enzyme Prediction     

No EC number prediction in MGYG000001970_02940.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	4	312	1.1e-96	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	4.81e-53	4	284	1	283	Glycosyl hydrolase family 26.
COG4124	ManB2	2.97e-13	142	284	162	322	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM01251.1	1.99e-156	1	311	6	334
CBK82137.1	2.19e-148	2	309	3	310
AEB13973.1	7.48e-139	1	311	2	310
AOZ93051.1	1.50e-127	3	313	9	319
AIQ66101.1	4.17e-125	1	313	8	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZM8_A	6.09e-59	5	313	147	446	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HPF_A	5.49e-57	3	309	6	305	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3WDQ_A	6.90e-52	3	312	34	350	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	4.55e-43	8	283	50	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6Q75_A	4.52e-34	1	309	21	322	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5AWB7	7.12e-59	2	313	27	349	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
G2Q4H7	1.22e-55	5	313	176	475	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P49425	6.29e-48	8	287	151	433	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P55296	8.44e-45	4	313	158	459	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1
P55298	1.02e-44	4	303	157	448	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000101	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001970_02940.